Products

View as table Download

ATP1B2 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, beta 2 polypeptide (ATP1B2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ATP1A2 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 2 polypeptide (ATP1A2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

SLC9A1 (Myc-DDK-tagged)-Human solute carrier family 9 (sodium/hydrogen exchanger), member 1 (SLC9A1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

COX7A2L (Myc-DDK-tagged)-Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

USD 98.00

USD 800.00

In Stock

ATP1A3 (Myc-DDK-tagged)-Human ATPase, Na+/K+ transporting, alpha 3 polypeptide (ATP1A3)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ATP2A2 (Myc-DDK-tagged)-Human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 (ATP2A2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP1A1 (untagged)-Human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ATP2A2 (untagged)-Human ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 (ATP2A2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

ATP1A1 (GFP-tagged) - Human ATPase, Na+/K+ transporting, alpha 1 polypeptide (ATP1A1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

COX7A2L (GFP-tagged) - Human cytochrome c oxidase subunit VIIa polypeptide 2 like (COX7A2L), nuclear gene encoding mitochondrial protein

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

CACNA1S (GFP-tagged) - Human calcium channel, voltage-dependent, L type, alpha 1S subunit (CACNA1S)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ATP1A2 (untagged)-Human ATPase, Na+/K+ transporting, alpha 2 polypeptide (ATP1A2)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CACNA1D (untagged)-Human calcium channel, voltage-dependent, L type, alpha 1D subunit (CACNA1D), transcript variant 1

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

(untagged)-Human ATPase, Na+/K+ transporting, alpha 3 polypeptide (ATP1A3)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

CACNG7 (untagged)-Human calcium channel, voltage-dependent, gamma subunit 7 (CACNG7)

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
SC122190 is the updated version of SC122107.

Lenti ORF clone of Human calcium channel, voltage-dependent, gamma subunit 4 (CACNG4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Goat Anti-CACNA1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-RARGRPSEEELQD, from the C Terminus of the protein sequence according to NP_000710.5.

COX4I2 (untagged)-Human cytochrome c oxidase subunit IV isoform 2 (lung) (COX4I2), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

COX7A1 (untagged)-Human cytochrome c oxidase subunit VIIa polypeptide 1 (muscle) (COX7A1), nuclear gene encoding mitochondrial protein

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-UCRC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-UCRC antibody: synthetic peptide directed towards the middle region of human UCRC. Synthetic peptide located within the following region: LFRRTSTFALTIIVGVMFFERAFDQGADAIYDHINEGKLWKHIKHKYENK

COX8A (untagged)-Human cytochrome c oxidase subunit VIIIA (ubiquitous) (COX8A)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None