Germany
Japan
United Kingdom
China
Recombinant protein of human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Products
View as table Download
HSD11B1 (Myc-DDK-tagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CYP19A1 (Myc-DDK-tagged)-Human cytochrome P450, family 19, subfamily A, polypeptide 1 (CYP19A1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CYP11B1 (Myc-DDK-tagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
UGT1A1 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A1 (UGT1A1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
UGT1A9 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SULT1E1 (Myc-DDK-tagged)-Human sulfotransferase family 1E, estrogen-preferring, member 1 (SULT1E1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
UGT1A6 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
METTL2B (Myc-DDK-tagged)-Human methyltransferase like 2B (METTL2B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
WBSCR22 (Myc-DDK-tagged)-Human Williams Beuren syndrome chromosome region 22 (WBSCR22), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
SULT2B1 (Myc-DDK-tagged)-Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
CYP19A1 (untagged)-Human cytochrome P450, family 19, subfamily A, polypeptide 1 (CYP19A1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
HSD11B2 (GFP-tagged) - Human hydroxysteroid (11-beta) dehydrogenase 2 (HSD11B2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Transient overexpression lysate of cytochrome P450, family 19, subfamily A, polypeptide 1 (CYP19A1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
HSD11B2 (untagged)-Human hydroxysteroid (11-beta) dehydrogenase 2 (HSD11B2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CYP19A1 (untagged)-Human cytochrome P450, family 19, subfamily A, polypeptide 1 (CYP19A1), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
AKR1D1 (untagged)-Human aldo-keto reductase family 1, member D1 (delta 4-3-ketosteroid-5-beta-reductase) (AKR1D1), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SRD5A2 (untagged)-Human steroid-5-alpha-reductase, alpha polypeptide 2 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 2) (SRD5A2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
HSD11B1 (untagged)-Human hydroxysteroid (11-beta) dehydrogenase 1 (HSD11B1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit anti-UGT1A1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human UGT1A1 |
LCMT1 (untagged)-Human leucine carboxyl methyltransferase 1 (LCMT1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
UGT1A6 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A6 (UGT1A6), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-STS Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STS antibody: synthetic peptide directed towards the middle region of human STS. Synthetic peptide located within the following region: EPTSNMDIFPTVAKLAGAPLPEDRIIDGRDLMPLLEGKSQRSDHEFLFHY |
STS (untagged)-Human steroid sulfatase (microsomal), isozyme S (STS)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
CYP11B1 (untagged)-Human cytochrome P450, family 11, subfamily B, polypeptide 1 (CYP11B1), nuclear gene encoding mitochondrial protein, transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
UGT1A4 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A4 (UGT1A4)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
SULT2B1 (untagged)-Human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
UGT2B28 (untagged)-Human UDP glucuronosyltransferase 2 family, polypeptide B28 (UGT2B28), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Goat Polyclonal Antibody against HSD11B1 / HDL
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CTSYNMDRFINK, from the C Terminus of the protein sequence according to NP_005516.1; NP_861420.1. |
Active filters
Pathways
- Androgen and estrogen metabolism
Citations
- Yes