Germany
Japan
United Kingdom
China
Products
Download
Rabbit Polyclonal Anti-GPR68 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR68 antibody is: synthetic peptide directed towards the middle region of Human GPR68. Synthetic peptide located within the following region: SIYFLMHEEVIEDENQHRVCFEHYPIQAWQRAINYYRFLVGFLFPICLLL |
Rabbit Polyclonal Anti-GPR52 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LOC684623 antibody is: synthetic peptide directed towards the middle region of Rat LOC684623. Synthetic peptide located within the following region: RARFPSHEVDASREAGHSPDRRYAMVLFRITSVFYMLWLPYIIYFLLESS |
ACKR3 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 330-358 amino acids from the C-terminal region of Human CXCR7. |
Rabbit Polyclonal Antibody against OPRS1 (N-term)
| Applications | FC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This OPRS1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 47-81 amino acids from the N-terminal region of human OPRS1. |
Rabbit polyclonal anti-MTR1A antibody
| Applications | IF |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MTR1A. |
Rabbit polyclonal anti-GPR126 antibody
| Applications | IF |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPR126. |
GPR183 / EBI2 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | GPR183 / EBI2 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human GPR183 / EBI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey (100%); Marmoset, Mouse, Rat, Hamster, Elephant, Panda, Dog, Bat, Bovine, Horse, Rabbit, Pig (93%); Opossum, Platypus, Catfish, Zebrafish (80%). |
Rabbit polyclonal CALCR Antibody (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CALCR antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 445-474 amino acids from the C-terminal region of human CALCR. |
Rabbit Polyclonal Anti-M1 Muscarinic Receptor (443-458)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)RKIPKRPGSVHRTPSR, corresponding to amino acid residues 443-458 of human M1 Muscarinic Receptor. Intracellular, C-terminus. |
Rabbit Polyclonal Anti-Melanocortin Receptor 4 (extracellular)
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)HRGMHTSLHLWNRSS, corresponding to amino acid residues 6-20 of human MC4R. Extracellular, N terminal. |
Rabbit Polyclonal Anti-CYSLTR1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CYSLTR1 / CYSLT1 antibody was raised against synthetic 20 amino acid peptide from 3rd extracellular domain of human CYSLTR1 / CYSLT1. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Rabbit, Guinea pig (85%); Bovine, Elephant, Horse, Pig (80%). |
Rabbit Polyclonal Anti-FZD4 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-FZD4 antibody: synthetic peptide directed towards the middle region of human FZD4. Synthetic peptide located within the following region: GITSGMWIWSAKTLHTWQKCSNRLVNSGKVKREKRGNGWVKPGKGSETVV |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: LTLKLYNNGFTSVQGYAFNGTKLDAVYLNKNKYLTVIDKDAFGGVYSGPS |
Rabbit Polyclonal Anti-AGTR1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-AGTR1 antibody: synthetic peptide directed towards the N terminal of human AGTR1. Synthetic peptide located within the following region: ILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVI |
Rabbit Polyclonal Anti-GPR6 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR6 antibody: synthetic peptide directed towards the N terminal of human GPR6. Synthetic peptide located within the following region: NASAASLNDSQVVVVAAEGAAAAATAAGGPDTGEWGPPAAAALGAGGGAN |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the N terminal of human GPR161. Synthetic peptide located within the following region: MSLNSSLSCRKELSNLTEEEGGEGGVIITQFIAIIVITIFVCLGNLVIVV |
Rabbit Polyclonal Anti-GPR161 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPR161 antibody: synthetic peptide directed towards the middle region of human GPR161. Synthetic peptide located within the following region: FLVMLVCYGFIFRVARVKARKVHCGTVVIVEEDAQRTGRKNSSTSTSSSG |
Goat Polyclonal Anti-CB1 (isoform a) Antibody
| Applications | WB |
| Reactivities | Human, Mouse (Expected from sequence similarity: Rat, Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CB1 (isoform a) Antibody: Peptide with sequence SNDIQYEDIKGDMAS-C, from the N Terminus of the protein sequence according to NP_057167.2. |
5 HT 2A (HTR2A) rabbit polyclonal antibody
| Applications | IF, IHC |
| Reactivities | Mouse, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | Multiple antigenic peptide (MAP) of an N-terminal synthetic sequence corresponding to amino acids (22–41) of rat 5HT2A receptor. |
CXCR4 rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Goat Anti-ADRA2A Antibody
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-TERRPNGLGPERS, from the internal region of the protein sequence according to NP_000672.2. |
Rabbit Polyclonal CCR5 Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit polyclonal antibody to MC1R (melanocortin 1 receptor (alpha melanocyte stimulating hormone receptor))
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 253 and 317 of MC1 Receptor (Uniprot ID#Q01726) |
Goat Anti-S1PR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-NYTKETLETQ, from the internal region of the protein sequence according to NP_004221.3. |
Rabbit polyclonal anti-FSHR antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human FSHR. |
Rabbit polyclonal anti-GPRC5A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human GPRC5A. |
Rabbit polyclonal anti-SUCNR1 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human SUCNR1. |
Rabbit Polyclonal GluR2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GluR2 |
Rabbit polyclonal Anti-VPAC1 (extracellular)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide (C)EEAQLENETIG(S)SK, corresponding to amino acid residues 52-65 of human VPAC1 (Accession P32241). Extracellular, N-terminus. |
Rabbit anti-CHRM5 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human CHRM5 |
Rabbit Polyclonal Anti-GPCR5A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GPCR5A antibody: synthetic peptide directed towards the C terminal of human GPCR5A. Synthetic peptide located within the following region: SQEEITQGFEETGDTLYAPYSTHFQLQNQPPQKEFSIPRAHAWPSPYKDY |
Rabbit Polyclonal Anti-TSHR Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TSHR antibody: synthetic peptide directed towards the N terminal of human TSHR. Synthetic peptide located within the following region: CHQEEDFRVTCKDIQRIPSLPPSTQTLKLIETHLRTIPSHAFSNLPNISR |
Rabbit Polyclonal Anti-NTSR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NTSR1 antibody: synthetic peptide directed towards the N terminal of human NTSR1. Synthetic peptide located within the following region: FGNASGNASERVLAAPSSELDVNTDIYSKVLVTAVYLALFVVGTVGNTVT |
Rabbit Polyclonal Anti-CXCR4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Goat Polyclonal Anti-ADRA1B Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
Rabbit Polyclonal Anti-CHRM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human CHRM1 |
Active filters
Clonalities
- Polyclonal
Families
- GPCR
Filter by
Target Symbol
- CXCR4 (16)
- ADRA1B (13)
- F2R (13)
- ADRB2 (12)
- CASR (11)
- CRHR1 (11)
- HCRTR1 (11)
- HTR4 (11)
- CCR7 (10)
- CX3CR1 (10)
- FPR1 (10)
- GABBR1 (10)
- GRM7 (10)
- HTR7 (10)
- LGR5 (10)
- PTGER3 (10)
- SSTR1 (10)
- CCR5 (9)
- GRM3 (9)
- HTR5A (9)
- LPAR4 (9)
- NPY1R (9)
- NTSR1 (9)
- S1PR1 (9)
- SSTR2 (9)
- TSHR (9)
- ADRA2A (8)
- APLNR (8)
- CCR2 (8)
- CCR8 (8)
- CHRM1 (8)
- CNR2 (8)
- CXCR2 (8)
- CXCR3 (8)
- FZD2 (8)
- FZD4 (8)
- GHRHR (8)
- GRM1 (8)
- GRM2 (8)
- HTR1F (8)
- HTR2C (8)
- P2RY2 (8)
- ADORA2A (7)
- AVPR1B (7)
- BDKRB1 (7)
- CCR3 (7)
- CYSLTR1 (7)
- DRD1 (7)
- GIPR (7)
- GPR3 (7)
- GPR75 (7)
- GRM8 (7)
- HTR1A (7)
- KISS1R (7)
- NPY2R (7)
- OPN3 (7)
- OPRM1 (7)
- OR51E1 (7)
- PTGER2 (7)
- RXFP1 (7)
- S1PR3 (7)
- ADRA1A (6)
- ADRA2C (6)
- ADRB3 (6)
- AGTR1 (6)
- BRS3 (6)
- CYSLTR2 (6)
- FFAR1 (6)
- FSHR (6)
- FZD9 (6)
- GHSR (6)
- GLP2R (6)
- GPR173 (6)
- GPR50 (6)
- GRM5 (6)
- GRPR (6)
- HRH1 (6)
- HRH2 (6)
- HRH4 (6)
- HTR1E (6)
- LPAR3 (6)
- LTB4R2 (6)
- MAS1 (6)
- MC1R (6)
- MC2R (6)
- MC4R (6)
- MC5R (6)
- MTNR1A (6)
- NMBR (6)
- P2RY13 (6)
- PTGDR2 (6)
- RXFP3 (6)
- SUCNR1 (6)
- TACR1 (6)
- ACKR1 (5)
- ACKR3 (5)
- ACKR4 (5)
- ADGRE5 (5)
- ADORA1 (5)
- ADORA2B (5)
Reactivities
- Human (1128)
- Mouse (507)
- Rat (452)
- Monkey (109)
- Dog (75)
- Bovine (59)
- Gorilla (56)
- Rabbit (46)
- Pig (45)
- Bat (39)
- Horse (37)
- Hamster (35)
- Gibbon (34)
- Cow (15)
- Chimpanzee (14)
- Chicken (10)
- Xenopus (10)
- Primate (9)
- Guinea Pig (8)
- Rhesus Monkey (6)
- Orang-Utan (5)
- Zebrafish (5)
- Canine (3)
- Sheep (3)
- X. tropicalis (2)
- Equine (1)
- Feline (1)
- Goat (1)
- Macaque (1)
- Murine (1)
- Porcine (1)
Applications
Antibody Hosts
Conjugates
Modifications
Pathways
- Neuroactive ligand-receptor interaction (877)
- Calcium signaling pathway (282)
- Chemokine signaling pathway (108)
- Cytokine-cytokine receptor interaction (108)
- Endocytosis (73)
- Vascular smooth muscle contraction (64)
- Melanogenesis (55)
- Gap junction (46)
- Basal cell carcinoma (44)
- Colorectal cancer (44)
- Pathways in cancer (44)
- Wnt signaling pathway (44)
- Regulation of actin cytoskeleton (43)
- Complement and coagulation cascades (31)
- Long-term depression (25)
- Olfactory transduction (21)
- Axon guidance (16)
- Leukocyte transendothelial migration (16)
- Renin-angiotensin system (16)
- Long-term potentiation (14)
- Epithelial cell signaling in Helicobacter pylori infection (12)
- Autoimmune thyroid disease (9)
- Huntington's disease (6)
- Dilated cardiomyopathy (5)
- GnRH signaling pathway (5)
- Parkinson's disease (5)
- Taste transduction (5)