ANAPC10 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 10 (ANAPC10)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 10 (ANAPC10)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human anaphase promoting complex subunit 10 (ANAPC10)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, ANAPC10 (Myc-DDK tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ANAPC10 (mGFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, ANAPC10 (Myc-DDK tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, ANAPC10 (mGFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (myc-DDK-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (myc-DDK-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-APC10 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10. |
Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of anaphase promoting complex subunit 10 (ANAPC10)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ANAPC10 (untagged)-Human anaphase promoting complex subunit 10 (ANAPC10)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal APC10 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10. |
ANAPC10 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-ANAPC10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10. Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL |
ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4
Vector | pCMV6 series |
Tag | Tag Free |
ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5
Vector | pCMV6 series |
Tag | Tag Free |
ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6
Vector | pCMV6 series |
Tag | Tag Free |
ANAPC10 (untagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
ANAPC10 (untagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7
Vector | pCMV6 series |
Tag | Tag Free |
Anti-ANAPC10 Rabbit Polyclonal Antibody
Applications | ELISA, IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Anti-ANAPC10 Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Full length fusion protein |
Transient overexpression of ANAPC10 (NM_014885) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256710) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256706) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256707) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256708) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256709) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256712) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_001256711) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ANAPC10 (NM_014885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack