Products

View as table Download

ANAPC10 (Myc-DDK-tagged)-Human anaphase promoting complex subunit 10 (ANAPC10)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ANAPC10 (Myc-DDK tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (Myc-DDK tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (myc-DDK-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (myc-DDK-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (GFP-tagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rabbit polyclonal anti-APC10 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids near the amino terminus of human APC10.

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Transient overexpression lysate of anaphase promoting complex subunit 10 (ANAPC10)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human anaphase promoting complex subunit 10 (ANAPC10), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ANAPC10 (untagged)-Human anaphase promoting complex subunit 10 (ANAPC10)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal APC10 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen APC10 antibody was raised against a 16 amino acid synthetic peptide near the center of human APC10.

ANAPC10 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-ANAPC10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ANAPC10 antibody: synthetic peptide directed towards the N terminal of human ANAPC10. Synthetic peptide located within the following region: MTTPNKTPPGADPKQLERTGTVREIGSQAVWSLSSCKPGFGVDQLRDDNL

ANAPC10 MS Standard C13 and N15-labeled recombinant protein (NP_055700)

Tag C-Myc/DDK
Expression Host HEK293

ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (GFP-tagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 1

Vector pCMV6 series
Tag Tag Free

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 3

Vector pCMV6 series
Tag Tag Free

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 4

Vector pCMV6 series
Tag Tag Free

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 5

Vector pCMV6 series
Tag Tag Free

ANAPC10 (untagged) - Homo sapiens anaphase promoting complex subunit 10 (ANAPC10), transcript variant 6

Vector pCMV6 series
Tag Tag Free

ANAPC10 (untagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 8

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

ANAPC10 (untagged) - Human anaphase promoting complex subunit 10 (ANAPC10), transcript variant 7

Vector pCMV6 series
Tag Tag Free

Anti-ANAPC10 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-ANAPC10 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Transient overexpression of ANAPC10 (NM_014885) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256710) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256706) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256707) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256708) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256709) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256712) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_001256711) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of ANAPC10 (NM_014885) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack