SMAD4 (Myc-DDK-tagged)-Human SMAD family member 4 (SMAD4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
SMAD4 (Myc-DDK-tagged)-Human SMAD family member 4 (SMAD4)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human SMAD family member 4 (SMAD4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
SMAD4 (untagged)-Human SMAD family member 4 (SMAD4)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
SMAD4 (GFP-tagged) - Human SMAD family member 4 (SMAD4)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, SMAD4 (mGFP-tagged) - Human SMAD family member 4 (SMAD4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF particles, SMAD4 (Myc-DDK tagged) - Human SMAD family member 4 (SMAD4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF clone of Human SMAD family member 4 (SMAD4), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAD4 (Myc-DDK tagged) - Human SMAD family member 4 (SMAD4), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, SMAD4 (mGFP-tagged) - Human SMAD family member 4 (SMAD4), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human SMAD family member 4 (SMAD4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of SMAD family member 4 (SMAD4)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit anti-SMAD4 Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human SMAD4 |
Lenti ORF clone of Human SMAD family member 4 (SMAD4), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal SMAD4 Antibody (C-term)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4. |
SMAD4 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Rabbit Polyclonal Anti-Smad4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Smad4 Antibody: A synthesized peptide derived from human Smad4 |
Lenti ORF clone of Human SMAD family member 4 (SMAD4), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-SMAD4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the N terminal of human SMAD4. Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK |
SMAD4 mouse monoclonal antibody, clone IMD-89, Purified
Applications | IF, WB |
Reactivities | Human |
Rabbit Polyclonal Antibody against SMAD4 (T277)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-284 amino acids from human SMAD4. |
Rabbit polyclonal Smad4 antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human Smad4. |
Rabbit Polyclonal Anti-SMAD4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the middle region of human SMAD4. Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST |
SMAD4 (1-552, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
SMAD4 (1-552, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
SMAD4 MS Standard C13 and N15-labeled recombinant protein (NP_005350)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Anti-SMAD4 Rabbit Polyclonal Antibody
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4 |
Transient overexpression of SMAD4 (NM_005359) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human SMAD family member 4 (SMAD4)
Tag | C-His |
Expression Host | E. coli |
Purified recombinant protein of Human SMAD family member 4 (SMAD4)
Tag | C-His |
Expression Host | E. coli |
Purified recombinant protein of Human SMAD family member 4 (SMAD4)
Tag | C-His |
Expression Host | E. coli |
Purified recombinant protein of Human SMAD family member 4 (SMAD4), Ala152-Tyr322, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human SMAD family member 4 (SMAD4), 1Met-195Tyr, with N-terminal His tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Transient overexpression of SMAD4 (NM_005359) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of SMAD4 (NM_005359) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack