Recombinant protein of human ligase I, DNA, ATP-dependent (LIG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Recombinant protein of human ligase I, DNA, ATP-dependent (LIG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
LIG1 (Myc-DDK-tagged)-Human ligase I, DNA, ATP-dependent (LIG1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LIG1 (GFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, LIG1 (Myc-DDK tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, LIG1 (mGFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human ligase I, DNA, ATP-dependent (LIG1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, LIG1 (Myc-DDK tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ligase I, DNA, ATP-dependent (LIG1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, LIG1 (mGFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
LIG1 (myc-DDK-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LIG1 (myc-DDK-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
LIG1 Rabbit Polyclonal Antibody
Applications | ICC/IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human LIG1 |
LIG1 (untagged)-Human ligase I, DNA, ATP-dependent (LIG1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
DNA Ligase I (LIG1) mouse monoclonal antibody, clone 10G12, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human |
Lenti ORF clone of Human ligase I, DNA, ATP-dependent (LIG1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
DNA Ligase I (LIG1) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
LIG1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
DNA Ligase I (LIG1) (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DNA ligase 1 |
Goat Anti-LIG1 / DNA ligase I Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1. |
Rabbit Polyclonal Anti-LIG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR |
Rabbit Polyclonal Anti-LIG1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF |
Transient overexpression lysate of ligase I, DNA, ATP-dependent (LIG1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
LIG1 MS Standard C13 and N15-labeled recombinant protein (NP_000225)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
LIG1 (GFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
LIG1 (GFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
LIG1 (untagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
LIG1 (untagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-LIG1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human LIG1 |
Transient overexpression of LIG1 (NM_000234) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LIG1 (NM_001289064) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LIG1 (NM_001289063) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LIG1 (NM_000234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LIG1 (NM_000234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LIG1 (NM_001289064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LIG1 (NM_001289063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack