DUSP10 (Myc-DDK-tagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DUSP10 (Myc-DDK-tagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
DUSP10 (Myc-DDK-tagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DUSP10 (Myc-DDK tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, DUSP10 (mGFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
DUSP10 (GFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DUSP10 (GFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
DUSP10 (untagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DUSP10 (Myc-DDK tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DUSP10 (mGFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DUSP10 (Myc-DDK tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, DUSP10 (mGFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human DUSP10 |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of dual specificity phosphatase 10 (DUSP10), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal DUSP10 antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10. |
DUSP10 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
DUSP10 (untagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human dual specificity phosphatase 10 (DUSP10), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Purified recombinant protein of Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
DUSP10 (untagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against DUSP10 / MKP5
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence CRILTPKLMGVETVV, from the C Terminus of the protein sequence according to NP_009138.1; NP_653329.1; NP_653330.1. |
Rabbit Polyclonal Anti-DUSP10 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10. Synthetic peptide located within the following region: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE |
DUSP10 / MKP5 (149-482, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
DUSP10 / MKP5 (149-482, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of dual specificity phosphatase 10 (DUSP10), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI2H1 (formerly 2H1), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |