F2 (Myc-DDK-tagged)-Human coagulation factor II (thrombin) (F2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
F2 (Myc-DDK-tagged)-Human coagulation factor II (thrombin) (F2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human coagulation factor II (thrombin) (F2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, F2 (Myc-DDK tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, F2 (mGFP-tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
F2 (GFP-tagged) - Human coagulation factor II (thrombin) (F2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
F2 (untagged)-Human coagulation factor II (thrombin) (F2)
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, F2 (Myc-DDK tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, F2 (mGFP-tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-F2 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
Lenti ORF clone of Human coagulation factor II (thrombin) (F2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of coagulation factor II (thrombin) (F2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-F2 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR |
Rabbit Polyclonal Anti-THRB Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
Lenti ORF clone of Human coagulation factor II (thrombin) (F2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal Prothrombin / THRB (AP2, Cleaved-Arg327) antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from human THRB. |
Purified recombinant protein of Human coagulation factor II (thrombin) (F2), esidues 44aa-end, with N-terminal His tag, expressed in human cells;
Tag | N-His |
Expression Host | HEK293 |
Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Biotin
Applications | ELISA, WB |
Reactivities | Human |
Conjugation | Biotin |
Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Purified
Applications | ELISA, WB |
Reactivities | Human |
F2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
F2 MS Standard C13 and N15-labeled recombinant protein (NP_000497)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Prothrombin (F2) (328-622, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
Prothrombin (F2) (328-622, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Lenti ORF clone of Human coagulation factor II (thrombin) (F2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-F2 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human F2 |
F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
F2 mouse monoclonal antibody,clone OTI5B11, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
F2 mouse monoclonal antibody,clone OTI5B11, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
F2 mouse monoclonal antibody,clone OTI5B11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
F2 mouse monoclonal antibody,clone OTI5G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
F2 mouse monoclonal antibody,clone OTI5G10, Biotinylated
Applications | WB |
Reactivities | Human |
Conjugation | Biotin |
USD 420.00
4 Weeks
F2 mouse monoclonal antibody,clone OTI5G10, HRP conjugated
Applications | WB |
Reactivities | Human |
Conjugation | HRP |
F2 mouse monoclonal antibody,clone OTI5G10
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Transient overexpression of F2 (NM_000506) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of F2 (NM_000506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of F2 (NM_000506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack