Germany
Japan
United Kingdom
China
F2 (Myc-DDK-tagged)-Human coagulation factor II (thrombin) (F2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human coagulation factor II (thrombin) (F2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
USD 820.00
3 Weeks
Lenti ORF particles, F2 (Myc-DDK tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, F2 (mGFP-tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
F2 (Myc-DDK-tagged) - Mouse coagulation factor II (F2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
F2 (GFP-tagged) - Human coagulation factor II (thrombin) (F2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
F2 (untagged)-Human coagulation factor II (thrombin) (F2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
F2 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN505470 is the updated version of KN305470.
F2 (GFP-tagged) - Mouse coagulation factor II (F2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of F2 (Myc-DDK-tagged) - Mouse coagulation factor II (F2)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, F2 (Myc-DDK-tagged) - Mouse coagulation factor II (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of F2 (mGFP-tagged) - Mouse coagulation factor II (F2)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, F2 (GFP-tagged) - Mouse coagulation factor II (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
5 Weeks
Lenti ORF particles, F2 (Myc-DDK tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, F2 (mGFP-tagged) - Human coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
F2 (Myc-DDK-tagged ORF) - Rat coagulation factor II (thrombin) (F2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of F2 (Myc-DDK-tagged ORF) - Rat coagulation factor II (thrombin) (F2), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, F2 (Myc-DDK-tagged ORF) - Rat coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of F2 (mGFP-tagged ORF) - Rat coagulation factor II (thrombin) (F2), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, F2 (GFP-tagged ORF) - Rat coagulation factor II (thrombin) (F2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal Anti-F2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE |
F2 (untagged) - Mouse coagulation factor II (F2), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human coagulation factor II (thrombin) (F2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of coagulation factor II (thrombin) (F2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-F2 Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR |
Rabbit Polyclonal Anti-THRB Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB |
Lenti ORF clone of Human coagulation factor II (thrombin) (F2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal Prothrombin / THRB (AP2, Cleaved-Arg327) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human THRB. |
Purified recombinant protein of Human coagulation factor II (thrombin) (F2), esidues 44aa-end, with N-terminal His tag, expressed in human cells;
| Tag | N-His |
| Expression Host | HEK293 |
Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Biotin
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Biotin |
Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Purified
| Applications | ELISA, WB |
| Reactivities | Human |
F2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
F2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
F2 MS Standard C13 and N15-labeled recombinant protein (NP_000497)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Prothrombin (F2) (328-622, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Prothrombin (F2) (328-622, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
F2 CRISPRa kit - CRISPR gene activation of human coagulation factor II, thrombin
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
F2 CRISPRa kit - CRISPR gene activation of mouse coagulation factor II
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene F2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene F2
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
qPCR primer pairs and template standards against Mus musculus gene F2
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene F2
Lenti ORF clone of Human coagulation factor II (thrombin) (F2), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
F2 (untagged ORF) - Rat coagulation factor II (thrombin) (F2), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of coagulation factor II (thrombin) (F2) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
F2 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
F2 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- F2