Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNMB3 (Myc-DDK tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, KCNMB3 (mGFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
KCNMB2 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
KCNMB3 (GFP-tagged) - Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
KCNMB4 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCNMB1 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 1 (KCNMB1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
KCNMB3 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCNMB2 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-KCNMB2 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human KCNMB2. |
KCNMB1 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 42-72 amino acids from the Central region of human KCNMB1 |
KCNMB2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB3 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
KCNMB2 (untagged)-Human potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 2
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1,Gln87-Gln205, with N-terminal His-Trx tag, expressed in E. coli, 50ug
| Tag | N-His-Trx |
| Expression Host | E. coli |
KCNMB1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M, beta member 4 (KCNMB4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB3 Rabbit Polyclonal (C-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human, Gorilla |
| Immunogen | KCNMB3 antibody was raised against synthetic 15 amino acid peptide from C-terminus of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey (87%); Marmoset (80%). |
KCNMB3 Rabbit Polyclonal (Internal) Antibody
| Applications | IHC |
| Reactivities | Gorilla, Human |
| Immunogen | KCNMB3 antibody was raised against synthetic 17 amino acid peptide from internal region of human KCNMB3. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey (94%); Bovine, Bat, Horse (88%); Gibbon, Dog, Pig (82%). |
Mouse monoclonal BK Beta3a Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-BK Beta2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Mouse Monoclonal Anti-BKBeta4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-KCNMB3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KCNMB3 antibody: synthetic peptide directed towards the middle region of human KCNMB3. Synthetic peptide located within the following region: SLTLLGGALIVGMVRLTQHLSLLCEKYSTVVRDEVGGKVPYIEQHQFKLC |
Rabbit Polyclonal Anti-KCNMB2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-KCNMB2 antibody is: synthetic peptide directed towards the C-terminal region of Human KCNMB2. Synthetic peptide located within the following region: QKCSYIPKCGKNFEESMSLVNVVMENFRKYQHFSCYSDPEGNQKSVILTK |
KCNMB3 (82-207, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
KCNMB3 (82-207, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
KCNMB2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
KCNMB3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M, beta member 2 (KCNMB2), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of potassium large conductance calcium-activated channel, subfamily M beta member 3 (KCNMB3), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Germany
Japan
United Kingdom
China
