Germany
Japan
United Kingdom
China
DUSP10 (Myc-DDK-tagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
DUSP10 (Myc-DDK-tagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Lenti ORF particles, DUSP10 (Myc-DDK tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DUSP10 (mGFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DUSP10 (GFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DUSP10 (GFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DUSP10 (untagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP10 (Myc-DDK tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP10 (mGFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP10 (Myc-DDK tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DUSP10 (mGFP-tagged) - Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of dual specificity phosphatase 10 (DUSP10), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human dual specificity phosphatase 10 (DUSP10), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal DUSP10 antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human DUSP10. |
DUSP10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DUSP10 (untagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 1
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human dual specificity phosphatase 10 (DUSP10), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Purified recombinant protein of Human dual specificity phosphatase 10 (DUSP10), transcript variant 3, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-GST and C-His |
| Expression Host | E. coli |
DUSP10 (untagged)-Human dual specificity phosphatase 10 (DUSP10), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Goat Polyclonal Antibody against DUSP10 / MKP5
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence CRILTPKLMGVETVV, from the C Terminus of the protein sequence according to NP_009138.1; NP_653329.1; NP_653330.1. |
Rabbit Polyclonal Anti-DUSP10 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DUSP10 antibody: synthetic peptide directed towards the N terminal of human DUSP10. Synthetic peptide located within the following region: MQRLNIGYVINVTTHLPLYHYEKGLFNYKRLPATDSNKQNLRQYFEEAFE |
DUSP10 / MKP5 (149-482, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
DUSP10 / MKP5 (149-482, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DUSP10 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of dual specificity phosphatase 10 (DUSP10), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI1F2 (formerly 1F2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI2E3 (formerly 2E3)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
DUSP10 mouse monoclonal antibody, clone OTI3D8 (formerly 3D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Active filters
Target Symbol
- DUSP10
Families
- Phosphatase