Products

View as table Download

PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Purified recombinant protein of Homo sapiens protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

Special Offer: Get a 20% discount on this product. Use code: "MVPro20".

Lenti ORF particles, PPP2R5D (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PPP2R5D (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PPP2R5D (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5D (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5D (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5D (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5D (Myc-DDK tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5D (mGFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5D (Myc-DDK-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPP2R5D (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP2R5D (mGFP-tagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP2R5D (Myc-DDK tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5D (GFP-tagged) - Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP2R5D (GFP-tagged) - Homo sapiens protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-PPP2R5D Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP2R5D antibody: synthetic peptide directed towards the middle region of human PPP2R5D. Synthetic peptide located within the following region: ETEAVQMLKDIKKEKVLLRRKSELPQDVYTIKALEAHKRAEEFLTASQEA

Recombinant protein of human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug

Tag N-His
Expression Host E. coli

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Lenti ORF clone of Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 2

Vector pCMV6-XL6
Tag Tag Free
Mammalian Cell Selection None

PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

PPP2R5D rabbit polyclonal antibody, Purified

Applications WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen Synthetic peptide conjugated to KLH derived from the N-terminus of PP2A/B delta

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
LY405833 is the same product as LY430509.

Goat Polyclonal Antibody against PPP2R5D

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-KRAEEFLTASQEAL, from the C Terminus of the protein sequence according to NP_006236.

Rabbit polyclonal anti-PPP2R5D antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PPP2R5D.

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI5E7 (formerly 5E7)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI6C12 (formerly 6C12)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI10D11 (formerly 10D11)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PPP2R5D mouse monoclonal antibody, clone OTI2F2 (formerly 2F2)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPP2R5D HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of protein phosphatase 2, regulatory subunit B', delta isoform (PPP2R5D), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_851307)

Tag C-Myc/DDK
Expression Host HEK293

PPP2R5D MS Standard C13 and N15-labeled recombinant protein (NP_006236)

Tag C-Myc/DDK
Expression Host HEK293

PPP2R5D (untagged)-Human protein phosphatase 2, regulatory subunit B', delta (PPP2R5D), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
SC310326 is the updated version of SC127992.