Products

View as table Download

MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, MKNK1 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, MKNK1 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

MKNK1 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MKNK1 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MKNK1 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of MKNK1 (mGFP-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MKNK1 (mGFP-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MKNK1 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, MKNK1 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

MKNK1 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MKNK1 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

MKNK1 (untagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin

Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

MNK1 (MKNK1) mouse monoclonal antibody, clone 2F12, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

(untagged)-Human mRNA for MNK1, complete cds

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-MKNK1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MKNK1 Antibody: A synthesized peptide derived from human MKNK1

MKNK1 (untagged)-Kinase deficient mutant (K78M) of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal Mnk1 (Ab-385) antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Mnk1 around the phosphorylation site of threonine 385 (L-P-TP-P-Q).

Rabbit polyclonal anti-MKNK1 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human MKNK1.

Rabbit polyclonal MNK1 (Thr255) antibody(Phospho-specific)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human MNK1 around the phosphorylation site of threonine 255 (L-T-TP-P-C).
Modifications Phospho-specific

MKNK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

MKNK1 (untagged)-Kinase deficient mutant (K78M) of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit polyclonal anti-MNK1 antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human MNK1.

Rabbit Polyclonal Anti-MKNK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the C terminal of human MKNK1. Synthetic peptide located within the following region: HEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTA

Rabbit Polyclonal Anti-MKNK1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the N terminal of human MKNK1. Synthetic peptide located within the following region: CQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRV

MKNK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

MKNK1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675)

Tag C-Myc/DDK
Expression Host HEK293

MKNK1 (untagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

MKNK1 (untagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Transient overexpression of MKNK1 (NM_003684) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MKNK1 (NM_198973) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of MKNK1 (NM_001135553) in HEK293T cells paraffin embedded controls for ICC/IHC staining

USD 225.00

4 Weeks

Transient overexpression of MKNK1 (NM_003684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of MKNK1 (NM_003684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

USD 225.00

4 Weeks

Transient overexpression of MKNK1 (NM_198973) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack