MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, MKNK1 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, MKNK1 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
MKNK1 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MKNK1 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MKNK1 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MKNK1 (Myc-DDK-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of MKNK1 (mGFP-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, MKNK1 (mGFP-tagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, MKNK1 (Myc-DDK tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, MKNK1 (mGFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
MKNK1 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MKNK1 (GFP-tagged) - Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
MKNK1 (untagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
MNK1 (MKNK1) (1-466) mouse monoclonal antibody, clone 2H8, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
MNK1 (MKNK1) mouse monoclonal antibody, clone 2F12, Purified
Applications | ELISA, IF, IHC, WB |
Reactivities | Human |
(untagged)-Human mRNA for MNK1, complete cds
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 Antibody: A synthesized peptide derived from human MKNK1 |
MKNK1 (untagged)-Kinase deficient mutant (K78M) of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal Mnk1 (Ab-385) antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Mnk1 around the phosphorylation site of threonine 385 (L-P-TP-P-Q). |
Rabbit polyclonal anti-MKNK1 antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human MKNK1. |
Rabbit polyclonal MNK1 (Thr255) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human MNK1 around the phosphorylation site of threonine 255 (L-T-TP-P-C). |
Modifications | Phospho-specific |
MKNK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MKNK1 (untagged)-Kinase deficient mutant (K78M) of Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-MNK1 antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human MNK1. |
Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the C terminal of human MKNK1. Synthetic peptide located within the following region: HEENELAEEPEALADGLCSMKLSPPCKSRLARRRALAQAGRGEDRSPPTA |
Rabbit Polyclonal Anti-MKNK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MKNK1 antibody: synthetic peptide directed towards the N terminal of human MKNK1. Synthetic peptide located within the following region: CQGNKNILELIEFFEDDTRFYLVFEKLQGGSILAHIQKQKHFNEREASRV |
MKNK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MKNK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
MKNK1 MS Standard C13 and N15-labeled recombinant protein (NP_003675)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
MKNK1 (untagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
MKNK1 (untagged)-Human MAP kinase interacting serine/threonine kinase 1 (MKNK1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of MKNK1 (NM_003684) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MKNK1 (NM_198973) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MKNK1 (NM_001135553) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of MKNK1 (NM_003684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of MKNK1 (NM_003684) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of MKNK1 (NM_198973) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack