Products

Antibodies (29)
cDNA Clones (24)
Proteins (18)
Jump to Filters
View as table Download
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone
RC202461

USD 610.00

In Stock

HIF1A (Myc-DDK-tagged)-Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HIF-1 alpha (HIF1A) (NM_001530) Human Untagged Clone
SC119189

USD 540.00

In Stock

HIF1A (untagged)-Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HIF-1 alpha (HIF1A) (NM_001530) Human Over-expression Lysate
LY419880

USD 396.00

In Stock

Transient overexpression lysate of hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone
RG202461

USD 670.00

In Stock

HIF1A (GFP-tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone
RC218966

USD 610.00

In Stock

HIF1A (Myc-DDK-tagged)-Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
HIF-1 alpha (HIF1A) (NM_001530) Human Mutant ORF Clone
RC402571

USD 760.00

In Stock

HIF1A Mutant (A588T), Myc-DDK-tagged ORF clone of Homo sapiens hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1 as transfection-ready DNA

Mutation A588T
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone Lentiviral Particle
RC202461L1V

USD 1,010.00

2 Weeks

Lenti ORF particles, HIF1A (Myc-DDK tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone Lentiviral Particle
RC202461L2V

USD 1,010.00

3 Weeks

Lenti ORF particles, HIF1A (mGFP-tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone Lentiviral Particle
RC218966L1V

USD 1,010.00

3 Weeks

Lenti ORF particles, HIF1A (Myc-DDK tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone Lentiviral Particle
RC218966L2V

USD 1,010.00

3 Weeks

Lenti ORF particles, HIF1A (mGFP-tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone
RG218966

USD 670.00

In Stock

HIF1A (GFP-tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF1A
AB0112-200

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 780 aa to the C-terminus of human HIF1a produced in E. coli.
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone
RC202461L3

USD 810.00

In Stock

Lenti ORF clone of Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone Lentiviral Particle
RC202461L3V

USD 1,010.00

3 Weeks

Lenti ORF particles, HIF1A (Myc-DDK tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone
RC202461L4

USD 810.00

3 Weeks

Lenti ORF clone of Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone Lentiviral Particle
RC202461L4V

USD 1,010.00

5 Weeks

Lenti ORF particles, HIF1A (mGFP-tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone
RC218966L3

USD 810.00

3 Weeks

Lenti ORF clone of Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone Lentiviral Particle
RC218966L3V

USD 1,010.00

9 Weeks

Lenti ORF particles, HIF1A (Myc-DDK tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone
RC218966L4

USD 810.00

3 Weeks

Lenti ORF clone of Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Tagged ORF Clone Lentiviral Particle
RC218966L4V

USD 1,010.00

5 Weeks

Lenti ORF particles, HIF1A (mGFP-tagged) - Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
HIF-1 alpha (HIF1A) (NM_001243084) Human Tagged ORF Clone
RC234963

USD 750.00

5 Weeks

HIF1A (Myc-DDK tagged) - Homo sapiens hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF-1 alpha (HIF1A) (NM_001530) Human Mutant ORF Clone
RC402570

USD 760.00

3 Weeks

HIF1A Mutant (P582S), Myc-DDK-tagged ORF clone of Homo sapiens hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1 as transfection-ready DNA

Mutation P582S
Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF-1 alpha (HIF1A) (NM_001243084) Human Tagged ORF Clone
RG234963

USD 830.00

5 Weeks

HIF1A (GFP-tagged) - Homo sapiens hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
HIF-1 alpha (HIF1A) (NM_181054) Human Over-expression Lysate
LY403613

USD 605.00

2 Weeks

Transient overexpression lysate of hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HIF-1 alpha (HIF1A) Mouse Monoclonal Antibody [Clone ID: H1alpha67]
TA309691

USD 479.00

2 Weeks

Mouse Monoclonal HIF-1 alpha Antibody (H1alpha67)

Applications IHC, IP, WB
Reactivities Bovine, Ferret, Human, Mouse, Porcine, Primate, Rat, Sheep
Conjugation Unconjugated
HIF-1 alpha (HIF1A) (NM_181054) Human Untagged Clone
SC127304

USD 1,480.00

In Stock

HIF1A (untagged)-Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA324790

USD 450.00

2 Weeks

Rabbit polyclonal HIF1A Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human, Hamster
Conjugation Unconjugated
Immunogen This HIF1A antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human HIF1A.
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA325528

USD 345.00

4 Weeks

Rabbit Polyclonal HIF1A antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthesized peptide derived from human HIF1A
HIF1A
AB0070-100

USD 320.00

In Stock

Goat Polyclonal Anti-HIF1a Antibody

Applications WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen Purified recombinant peptide derived from within residues 470 to 590 aa of human HIF1a produced in E. coli.
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
AP23253PU-N

USD 405.00

2 Weeks

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Immunogen A peptide mapping at the N-terminus of HIF-1α of Human origin, different from the related Rat and Mouse sequences by two sequences.
HIF-1 alpha (HIF1A) (NM_001530) Human Tagged ORF Clone
RC202461L1

USD 810.00

In Stock

Lenti ORF clone of Human hypoxia inducible factor 1, alpha subunit (basic helix-loop-helix transcription factor) (HIF1A), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
AP20633PU-N

USD 407.00

2 Weeks

HIF-1 alpha (HIF1A) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA336308

USD 479.00

2 Weeks

Rabbit Polyclonal HIF-1 alpha Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Goat, Hamster, Rabbit, Primate
Conjugation Unconjugated
Immunogen A fusion protein including residues 530-825 of the mouse HIF-1 alpha protein. [UniProt# Q61221]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA319212

USD 530.00

2 Weeks

Rabbit polyclonal Hif-1 alpha hydroxy P564 antibody

Applications WB
Reactivities Bovine, Human, Monkey, Mouse, Rat, Xenopus, Dog
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to a region surrounding the P564 of human HIF-1a.
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA336260

USD 479.00

5 Days

Rabbit Polyclonal HIF-1 alpha Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat, Canine, Guinea Pig, Primate, Xenopus
Conjugation Unconjugated
Immunogen Fusion protein made to an internal sequence of human HIF-1 alpha (containing amino acids 432-528) [UniProt Q16665]
HIF-1 alpha (HIF1A) (NM_181054) Human Over-expression Lysate
LC403613

USD 187.00

In Stock

HIF1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HIF-1 alpha (HIF1A) (NM_001530) Human Over-expression Lysate
LC419880

USD 121.00

In Stock

HIF1A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA319213

USD 530.00

5 Days

Rabbit polyclonal HMGN phospho S20/S24 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 19-28 of human HMGN protein (see below).
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA329159

USD 375.00

5 Days

Rabbit Polyclonal anti-HIF1A antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the N terminal of human HIF1A. Synthetic peptide located within the following region: EGAGGANDKKKISSERRKEKSRDAARSRRSKESEVFYELAHQLPLPHNVS
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA335200

USD 375.00

5 Days

Rabbit Polyclonal Anti-HIF1A Antibody

Applications WB
Reactivities Chicken, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-HIF1A antibody: synthetic peptide directed towards the middle region of human HIF1A. Synthetic peptide located within the following region: VKGCKSSEQNGMEQKTIILIPSDLACRLLGQSMDESGLPQLTSYDCEVNA
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA336704

USD 424.00

5 Days

Rabbit Polyclonal HIF-1 alpha Antibody

Applications WB
Reactivities Human, Mouse, Porcine
Conjugation Unconjugated
Immunogen Genomic sequence made to an internal portion of human HIF-1 alpha (within residues 400-550). [Swiss-Prot# Q16665]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA336484

USD 424.00

5 Days

Rabbit Polyclonal HIF-1 alpha Antibody

Applications WB
Reactivities Human, Mouse, Rat, Porcine
Conjugation Unconjugated
Immunogen Fusion protein containing amino acids 432-528 of human HIF-1 alpha [UniProt# Q16665]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody [Clone ID: exon 9]
TA336763

USD 424.00

5 Days

Rabbit Polyclonal HIF-1 alpha [Exon 9] Antibody (exon 9)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 350-400). [Swiss-Prot# Q16665]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody [Clone ID: exon 10]
TA336764

USD 402.00

5 Days

Rabbit Polyclonal HIF-1 alpha [Exon 10] Antibody (exon 10)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 400-450). [Swiss-Prot# Q16665]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody [Clone ID: exon 12]
TA336765

USD 424.00

5 Days

Rabbit Polyclonal HIF-1 alpha [Exon 12] Antibody (exon 12)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 550-600). [Swiss-Prot# Q16665]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody [Clone ID: exon 13]
TA336766

USD 402.00

5 Days

Rabbit Polyclonal HIF-1 alpha [Exon 13] Antibody (exon 13)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human HIF-1 alpha protein (within residues 700-750). [Swiss-Prot# Q16665]
HIF-1 alpha (HIF1A) Rabbit Polyclonal Antibody
TA354706

USD 355.00

5 Days

Rabbit anti HIF, alpha Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A twenty-one amino acids synthetic peptide corresponding to the internal sequence of HIF alpha protein. This sequence is identical to human, rat and mouse origins.