Products

View as table Download

USD 98.00

USD 560.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8D

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8E

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A

Tag C-Myc/DDK
Expression Host HEK293T

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PAX8 (untagged)-Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal antibody to PAX8CC (paired box 8)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8

Anti-PAX8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human paired box 8

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX8 antibody is: synthetic peptide directed towards the middle region of Human PAX8. Synthetic peptide located within the following region: YSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFS

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the N terminal of human PAX8. Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

PAX8 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit Polyclonal Anti-PAX8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8. Synthetic peptide located within the following region: SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW

Mouse anti PAX8 Monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated

Rabbit anti PAX8 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of human PAX8. It is identical to human, rat, and mouse

PAX8 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PAX8

PAX8 (1-287, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

Goat Polyclonal Antibody against PAX8 (internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AQPGSDKRKMDD, from the internal region of the protein sequence according to NP_003457.1; NP_039245.1; NP_039246.1; NP_039247.1; NP_054698.1.

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX8 Antibody is: synthetic peptide directed towards the C-terminal region of Human PAX8. Synthetic peptide located within the following region: TPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSA

PAX8 (1-287, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB