Products

View as table Download

SMAD4 (Myc-DDK-tagged)-Human SMAD family member 4 (SMAD4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human SMAD family member 4 (SMAD4)

Tag C-Myc/DDK
Expression Host HEK293T

SMAD4 (untagged)-Human SMAD family member 4 (SMAD4)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

SMAD4 (GFP-tagged) - Human SMAD family member 4 (SMAD4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human SMAD family member 4 (SMAD4), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Rabbit anti-SMAD4 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human SMAD4

Lenti ORF clone of Human SMAD family member 4 (SMAD4), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit polyclonal SMAD4 Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 400-428 amino acids from the C-terminal region of human SMAD4.

SMAD4 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T

Rabbit Polyclonal Anti-Smad4 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-Smad4 Antibody: A synthesized peptide derived from human Smad4

Lenti ORF clone of Human SMAD family member 4 (SMAD4), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-SMAD4 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the N terminal of human SMAD4. Synthetic peptide located within the following region: MDNMSITNTPTSNDACLSIVHSLMCHRQGGESETFAKRAIESLVKKLKEK

SMAD4 mouse monoclonal antibody, clone IMD-89, Purified

Applications IF, WB
Reactivities Human

Rabbit Polyclonal Antibody against SMAD4 (T277)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This SMAD4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 255-284 amino acids from human SMAD4.

Rabbit polyclonal Smad4 antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human Smad4.

Rabbit Polyclonal Anti-SMAD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-SMAD4 antibody: synthetic peptide directed towards the middle region of human SMAD4. Synthetic peptide located within the following region: NIPVASTSQPASILGGSHSEGLLQIASGPQPGQQQNGFTGQPATYHHNST

SMAD4 (1-552, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli

SMAD4 (1-552, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli

SMAD4 MS Standard C13 and N15-labeled recombinant protein (NP_005350)

Tag C-Myc/DDK
Expression Host HEK293

Anti-SMAD4 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 14-227 amino acids of Human Mothers against decapentaplegic homolog 4

USD 1,130.00

4 Weeks

Transient overexpression of SMAD4 (NM_005359) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human SMAD family member 4 (SMAD4)

Tag C-His
Expression Host E. coli

Purified recombinant protein of Human SMAD family member 4 (SMAD4)

Tag C-His
Expression Host E. coli

Purified recombinant protein of Human SMAD family member 4 (SMAD4)

Tag C-His
Expression Host E. coli

Purified recombinant protein of Human SMAD family member 4 (SMAD4), Ala152-Tyr322, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

Purified recombinant protein of Human SMAD family member 4 (SMAD4), 1Met-195Tyr, with N-terminal His tag, expressed in E.coli, 50ug

Tag N-His
Expression Host E. coli

USD 225.00

4 Weeks

Transient overexpression of SMAD4 (NM_005359) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

USD 889.00

4 Weeks

Transient overexpression of SMAD4 (NM_005359) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack