Rabbit Polyclonal Anti-ARAF Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ARAF antibody: synthetic peptide directed towards the middle region of human ARAF. Synthetic peptide located within the following region: PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW |
Rabbit Polyclonal Anti-PML Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PML Antibody: synthetic peptide directed towards the N terminal of human PML. Synthetic peptide located within the following region: PSPSPSPTERAPASEEEFQFLRCQQCQAEAKCPKLLPCLHTLCSGCLEAS |
Rabbit Polyclonal Anti-SPI1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SPI1 Antibody: synthetic peptide directed towards the middle region of human SPI1. Synthetic peptide located within the following region: QKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAER |
Rabbit Polyclonal Anti-PIM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIM1 antibody: synthetic peptide directed towards the N terminal of human PIM1. Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG |
Rabbit Polyclonal Anti-PIM1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIM1 antibody: synthetic peptide directed towards the N terminal of human PIM1. Synthetic peptide located within the following region: MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFG |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the N terminal of human TCF7. Synthetic peptide located within the following region: PQPQPPLHKANQPPHGVPQLSLYEHFNSPHPTPAPADISQKQVHRPLQTP |
Rabbit Polyclonal Anti-PIM2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIM2 antibody: synthetic peptide directed towards the middle region of human PIM2. Synthetic peptide located within the following region: LRRGCAKLIDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVW |
Rabbit Polyclonal Anti-UBE2Z Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Ube2z antibody is: synthetic peptide directed towards the C-terminal region of Rat Ube2z. Synthetic peptide located within the following region: ISSVLISIQSLMTENPYHNEPGFEQERHPGDSKNYNECIRHETIRVAVCD |
Rabbit Polyclonal Anti-ZBTB16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZBTB16 antibody: synthetic peptide directed towards the C terminal of human ZBTB16. Synthetic peptide located within the following region: GASPYQCTICTEYCPSLSSMQKHMKGHKPEEIPPDWRIEKTYLYLCYV |
Rabbit anti Cyclin D1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of human cyclin D1 protein. This sequence is identical to human, mouse, rat. |
Rabbit anti NFkB p65 Polyclonal Antibody
| Reactivities | Human, Rabbit, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal domain of human NF?B p65. |
Rabbit anti ERK1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti STAT5a Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti NFkB p50 Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti STAT3 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide surrounding to the epitope -PMSPR-- without phosphorylation sites at Ser727 of STAT3 protein from human, mouse, rat, chicken dog and bovine origins. |
Rabbit anti ERK2 Polyclonal Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from C-terminus of ERK2 protein from human, rat, mouse and dog origins. |
Rabbit anti Raf -A Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A Synthetic peptide derived from N-term of Raf-A conjugated to KLH |
Rabbit anti P38 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human PID/MTA2. This sequence is identical within human, rat, mouse, bovine and dog origins. |
Rabbit anti I-Kappa-B Kinase b (IKKb) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The full length of human IKKβ recombinant protein. |
Rabbit anti Mek1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Mek2 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti Raf1 Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti STAT5b Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit anti NFkBp65 (pS276) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LRRPSDRE- with the phosphorylation site Ser276 of human NF-kB p65 protein. This sequence is identical to human, mouse and rat. |
Rabbit anti P70S6K Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
Rabbit anti PPARb Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The full-length recombinant protein of human PPAR-beta. |
Rabbit anti PPARd Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti AKT1/PKBa Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the close to C-term of human AKT1 protein. |
Rabbit anti AKT1/PKBa(pT308) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing the phospho-Thr308 motif (GATMKTFCG) of human AKT1. |
Rabbit anti AKT1/PKBa(pS473) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing the phosphorylated Ser473 motif of human AKT1. |
Rabbit anti AKT2/PKBb Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope 455-469 aa of human AKT2 protein. |
Rabbit anti AKT3/PKBg Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the intra domain 120-132aa of human AKT3 protein. |
Rabbit anti c-Myc Polyclonal Antibody
| Conjugation | Unconjugated |
Rabbit anti CD117 (kit) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Rokhlin OW, et al. a prostate-specific surface-reactive monoclonal antibody. Cancer Lett. 131: 129-136, 1998. |
Rabbit anti S6K(pS434) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the epitope –IRSPR- at a phosphorylation site at serine 434 of human p70S6K protein. This sequence is identical within human, rat, mouse, bovine, chicken and dog. |
Rabbit anti IKK-alpha Polyclonal Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit anti CD117/Kit (NT)/c-Kit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from N-terminus of human Kit protein. This sequence is identical among human and dog origins. |
Rabbit anti CD117/Kit (IN)/c-Kit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from extracellular domain of Kit protein. This sequence is identical in human and dog origins. |
Rabbit anti p70S6K Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide corresponding to the C-terminus of human p70S6K protein. This sequence is identical within human, rat, mouse, bovine, chicken and dog. |
Rabbit anti NF-?B p105/p50 Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti ERK1/2 (P44-MAPK) (pT202/pY204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat, ChiChickenen |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- with the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti ERK1/2 (P44-MAPK) (PairedT202/Y204) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –LTEYV- without the dual phosphorylation sites Thr202 and Tyr204 of ERK1/2 protein from human, rat, mouse and dog origins |
Rabbit anti ERK1/2 (P44-MAPK) Polyclonal Antibody
| Applications | WB |
| Reactivities | Chicken, Human, Mouse, Rat, Canis |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from internal sequence of ERK1/2 protein from human, rat, mouse and dog origins. |
Rabbit anti Myc(pT358) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti Myc(pT58) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti NF?B-p65(pS468) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –DASVDN- with the phosphorylation site Ser468 of human NF-?B p65 protein. This sequence is identical to human, mouse and rat. |
Rabbit anti NF?B-p65(pT435) Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –GEGTLSEP- with the phosphorylation site Thr435 of human NF-?B p65 protein. This sequence is identical to human, mouse and rat. |
Rabbit anti NF-?B p105/p50(pS337) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Rabbit anti AKT1 (paried T308) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide containing the motif (GATMKTFCG) without phosphorylation at Thr308 of human AKT1. |
Rabbit anti NFkBp65(PairedT254) Polyclonal Antibody
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide derived from epitope –FRTPP- with the Non-phosphorylation site Thr254 of human NF-kB p65 protein. This sequence is identical to human, mouse and rat. |
Germany
Japan
United Kingdom
China
