Germany
Japan
United Kingdom
China
IMPDH1 (GFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadIMPDH1 (GFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 5
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IMPDH1 (GFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 6
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IMPDH1 (GFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IMPDH1 (GFP-tagged) - Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Impdh1 (Myc-DDK-tagged ORF) - Rat IMP (inosine monophosphate) dehydrogenase 1 (Impdh1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Impdh1 (Myc-DDK-tagged ORF) - Rat IMP (inosine monophosphate) dehydrogenase 1 (Impdh1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Impdh1 (Myc-DDK-tagged ORF) - Rat IMP (inosine monophosphate) dehydrogenase 1 (Impdh1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Impdh1 (mGFP-tagged ORF) - Rat IMP (inosine monophosphate) dehydrogenase 1 (Impdh1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Impdh1 (GFP-tagged ORF) - Rat IMP (inosine monophosphate) dehydrogenase 1 (Impdh1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
IMPDH1 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
IMPDH1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-IMPDH1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH1 Antibody: synthetic peptide directed towards the middle region of human IMPDH1. Synthetic peptide located within the following region: KKGKLPIVNDCDELVAIIARTDLKKNRDYPLASKDSQKQLLCGAAVGTRE |
Rabbit Polyclonal Anti-IMPDH1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-IMPDH1 Antibody is: synthetic peptide directed towards the C-terminal region of IMPDH1. Synthetic peptide located within the following region: DGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSI |
Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
IMPDH1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
IMPDH1 / IMPD1 (1-514, His-tag) human recombinant protein, 0.25 mg
| Tag | His-tag |
| Expression Host | E. coli |
IMPDH1 / IMPD1 (1-514, His-tag) human recombinant protein, 50 µg
| Tag | His-tag |
| Expression Host | E. coli |
IMPDH1 CRISPRa kit - CRISPR gene activation of human inosine monophosphate dehydrogenase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Impdh1 CRISPRa kit - CRISPR gene activation of mouse inosine monophosphate dehydrogenase 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene IMPDH1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
IMPDH1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Impdh1 (untagged) - Mouse inosine 5'-phosphate dehydrogenase 1 (Impdh1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Impdh1 (untagged) - Mouse inosine 5'-phosphate dehydrogenase 1 (Impdh1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Impdh1 (untagged) - Mouse inosine 5'-phosphate dehydrogenase 1 (Impdh1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Impdh1
IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_899066)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
IMPDH1 MS Standard C13 and N15-labeled recombinant protein (NP_000874)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Impdh1 (untagged ORF) - Rat IMP (inosine monophosphate) dehydrogenase 1 (Impdh1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 7 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 6 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 3 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 5 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 4 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of IMP (inosine monophosphate) dehydrogenase 1 (IMPDH1) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
IMPDH1 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IMPDH1 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IMPDH1 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 5
| Vector | pCMV6 series |
| Tag | Tag Free |
IMPDH1 (untagged)-Human IMP (inosine 5'-monophosphate) dehydrogenase 1 (IMPDH1), transcript variant 7
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- IMPDH1