Germany
Japan
United Kingdom
China
RBPJ (GFP-tagged) - Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadRBPJ (GFP-tagged) - Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rbpj (Myc-DDK-tagged ORF) - Rat similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa) (LOC679028), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rbpj (Myc-DDK-tagged ORF) - Rat similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa) (LOC679028), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rbpj (Myc-DDK-tagged ORF) - Rat similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa) (LOC679028), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rbpj (mGFP-tagged ORF) - Rat similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa) (LOC679028), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rbpj (GFP-tagged ORF) - Rat similar to Recombining binding protein suppressor of hairless (J kappa-recombination signal binding protein) (RBP-J kappa) (LOC679028), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rbpj (untagged) - Mouse recombination signal binding protein for immunoglobulin kappa J region (cDNA clone MGC:54902, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rbpj - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Lenti ORF clone of Rbpj (mGFP-tagged) - Mouse recombination signal binding protein for immunoglobulin kappa J region (Rbpj), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti-ORF clone of RBPJ (Myc-DDK-tagged)-Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 2
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rbpj (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rbpj - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Lenti ORF clone of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rbpj - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
RBPJ HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
RBPJ HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Rbpj
RBPJ (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320629 is the updated version of SR302358.
Lenti ORF clone of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of RBPJ (mGFP-tagged)-Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 2
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RBPJ (untagged)-Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal antibody to RBP-Jkappa (recombination signal binding protein for immunoglobulin kappa J region)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 258 and 500 of RBP-Jkappa (Uniprot ID#Q06330) |
Rabbit polyclonal RBPJ Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This RBPJ antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-29 amino acids from the N-terminal region of human RBPJ. |
Rabbit Polyclonal anti-RBPSUH antibody
| Applications | IHC, IP, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RBPSUH antibody: synthetic peptide directed towards the C terminal of human RBPSUH. Synthetic peptide located within the following region: RPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS |
RBPJ HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
RBPJ (untagged)-Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 2
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RBPJ (untagged)-Human recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-Rbpj Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Rbpj antibody is: synthetic peptide directed towards the middle region of Mouse Rbpj. Synthetic peptide located within the following region: MGPVLAPVTPVPVVESLQLNGGGDVAMLELTGQNFTPNLRVWFGDVEAET |
RBPJ - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Rbpj - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Carrier-free (BSA/glycerol-free) RBPJ mouse monoclonal antibody,clone OTI4G10
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) RBPJ mouse monoclonal antibody,clone OTI6G5
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
RBPJ CRISPRa kit - CRISPR gene activation of human recombination signal binding protein for immunoglobulin kappa J region
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Rbpj CRISPRa kit - CRISPR gene activation of mouse recombination signal binding protein for immunoglobulin kappa J region
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene RBPJ
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene RBPJ
| Application | Plasmid of exact quantity for transcript copy number calculation |
qPCR primer pairs and template standards against Homo sapiens gene RBPJ
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene RBPJ
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
RBPJ HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LY404367 is the same product as LY430905.
Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 4
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of recombination signal binding protein for immunoglobulin kappa J region (RBPJ), transcript variant 3
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rbpj (untagged) - Mouse recombination signal binding protein for immunoglobulin kappa J region (Rbpj), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Active filters
Target Symbol
- RBPJ