Products

Antibodies (17)
Proteins (10)
cDNA Clones (10)
Jump to Filters
View as table Download
Prothrombin (F2) (NM_000506) Human Recombinant Protein
TP308589

USD 823.00

In Stock

Recombinant protein of human coagulation factor II (thrombin) (F2)

Tag C-Myc/DDK
Expression Host HEK293T
Prothrombin (F2) (NM_000506) Human Tagged ORF Clone
RG208589

USD 460.00

In Stock

F2 (GFP-tagged) - Human coagulation factor II (thrombin) (F2)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Prothrombin (F2) (NM_000506) Human Untagged Clone
SC321484

USD 310.00

In Stock

F2 (untagged)-Human coagulation factor II (thrombin) (F2)

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346200

USD 475.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide directed towards the middle region of human F2. Synthetic peptide located within the following region: ISDRWVLTAAHCLLYPPWDKNFTENDLLVRIGKHSRTRYERNIEKISMLE
Prothrombin (F2) Rabbit Polyclonal Antibody
TA346199

USD 475.00

5 Days

Rabbit Polyclonal Anti-F2 Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-F2 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: CQLWRSRYPHRPDINSTTHPGADLKENFCRNPDSSTSGPWCYTTDPTVRR
Prothrombin (F2) Rabbit Polyclonal Antibody
TA347556

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-THRB Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-THRB Antibody: A synthesized peptide derived from human THRB
Prothrombin (F2) (NM_000506) Human Tagged ORF Clone
RC208589L2

USD 620.00

3 Weeks

Lenti ORF clone of Human coagulation factor II (thrombin) (F2), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Prothrombin (F2) Rabbit Polyclonal Antibody
TA313852

USD 345.00

In Stock

Rabbit polyclonal Prothrombin / THRB (AP2, Cleaved-Arg327) antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human THRB.
Prothrombin (F2) (NM_000506) Human Recombinant Protein
TP790103

USD 425.00

In Stock

Purified recombinant protein of Human coagulation factor II (thrombin) (F2), esidues 44aa-end, with N-terminal His tag, expressed in human cells;

Tag N-His
Expression Host HEK293
Prothrombin (F2) Mouse Monoclonal Antibody [Clone ID: CaPro-20]
AM31845BT-N

USD 385.00

2 Weeks

Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Biotin

Applications ELISA, WB
Reactivities Human
Conjugation Biotin
Prothrombin (F2) Mouse Monoclonal Antibody [Clone ID: CaPro-20]
AM31845PU-N

USD 475.00

2 Weeks

Prothrombin (F2) mouse monoclonal antibody, clone CaPro-20, Purified

Applications ELISA, WB
Reactivities Human
Prothrombin (F2) (NM_000506) Human Over-expression Lysate
LC400182

USD 121.00

In Stock

F2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Prothrombin (F2) (NM_000506) Human Mass Spec Standard
PH308589

USD 2,055.00

3 Weeks

F2 MS Standard C13 and N15-labeled recombinant protein (NP_000497)

Tag C-Myc/DDK
Expression Host HEK293
Prothrombin (F2) (328-622, His-tag) Human Protein
AR51483PU-N

USD 845.00

2 Weeks

Prothrombin (F2) (328-622, His-tag) human recombinant protein, 0.5 mg

Tag His-tag
Expression Host E. coli
Prothrombin (F2) (328-622, His-tag) Human Protein
AR51483PU-S

USD 330.00

2 Weeks

Prothrombin (F2) (328-622, His-tag) human recombinant protein, 0.1 mg

Tag His-tag
Expression Host E. coli
Prothrombin (F2) Mouse Monoclonal Antibody [Clone ID: OTI5B11]
CF812512

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5B11

Applications WB
Reactivities Human
Conjugation Unconjugated
Prothrombin (F2) Mouse Monoclonal Antibody [Clone ID: OTI5G10]
CF812513

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) F2 mouse monoclonal antibody,clone OTI5G10

Applications WB
Reactivities Human
Conjugation Unconjugated
Prothrombin (F2) (NM_000506) Human Tagged ORF Clone
RC208589L4

USD 620.00

In Stock

Lenti ORF clone of Human coagulation factor II (thrombin) (F2), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Prothrombin (F2) Rabbit Polyclonal Antibody
TA351802

USD 345.00

In Stock

Rabbit Polyclonal Anti-F2 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human F2
Prothrombin (F2) ICC Control Block
TB408589

USD 1,070.00

4 Weeks

Transient overexpression of F2 (NM_000506) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Prothrombin (F2) Cytosection
TS408589

USD 225.00

4 Weeks

Transient overexpression of F2 (NM_000506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Prothrombin (F2) Cytosection
TS408589P5

USD 889.00

4 Weeks

Transient overexpression of F2 (NM_000506) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack