Products

Antibodies (24)
cDNA Clones (20)
Proteins (13)
Jump to Filters
View as table Download
CK1 epsilon (CSNK1E) (NM_152221) Human Tagged ORF Clone
RG202436

USD 460.00

In Stock

CSNK1E (GFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CK1 epsilon (CSNK1E) (NM_001894) Human Tagged ORF Clone
RG221884

USD 460.00

In Stock

CSNK1E (GFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
CK1 epsilon (CSNK1E) (NM_152221) Human Tagged ORF Clone Lentiviral Particle
RC202436L3V

USD 820.00

5 Weeks

Lenti ORF particles, CSNK1E (Myc-DDK tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_152221) Human Tagged ORF Clone Lentiviral Particle
RC202436L4V

USD 820.00

3 Weeks

Lenti ORF particles, CSNK1E (mGFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_001894) Human Tagged ORF Clone
RC221884L3

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_001894) Human Tagged ORF Clone Lentiviral Particle
RC221884L3V

USD 820.00

5 Weeks

Lenti ORF particles, CSNK1E (Myc-DDK tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_001894) Human Tagged ORF Clone
RC221884L4

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_001894) Human Tagged ORF Clone Lentiviral Particle
RC221884L4V

USD 820.00

7 Weeks

Lenti ORF particles, CSNK1E (mGFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_152221) Human Untagged Clone
SC320172

USD 310.00

In Stock

CSNK1E (untagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
CK1 epsilon (CSNK1E) (NM_152221) Human Over-expression Lysate
LY403455

USD 396.00

In Stock

Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA312479

USD 345.00

In Stock

Rabbit polyclonal anti-CKI-e antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CKI-e.
TPTEP2-CSNK1E Rabbit Polyclonal Antibody
AP20419PU-N

USD 407.00

2 Weeks

TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε.
CK1 epsilon (CSNK1E) (NM_001894) Human Untagged Clone
SC126810

USD 310.00

In Stock

CSNK1E (untagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
CK1 epsilon (CSNK1E) (NM_152221) Human Untagged Clone
SC323364

USD 760.00

In Stock

CSNK1E (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, epsilon (CSNK1E), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
CK1 epsilon (CSNK1E) (NM_152221) Human Tagged ORF Clone
RC202436L2

USD 620.00

3 Weeks

Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
CK1 epsilon (CSNK1E) (NM_152221) Human Over-expression Lysate
LC403455

USD 121.00

In Stock

CSNK1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CK1 epsilon (CSNK1E) (NM_001894) Human Over-expression Lysate
LY419672

USD 396.00

5 Days

Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CK1 epsilon (CSNK1E) Goat Polyclonal Antibody
TA302458

USD 375.00

5 Days

Goat Polyclonal Antibody against CSNK1E

Applications WB
Reactivities Human
Immunogen Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1.
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA340032

USD 375.00

5 Days

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications WB
Reactivities Human
Immunogen The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI2B3]
CF803780

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5D4]
CF803799

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5C9]
CF803800

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) (NM_001894) Human Over-expression Lysate
LC419672

USD 121.00

2 Weeks

CSNK1E HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
CK1 epsilon (CSNK1E) (NM_152221) Human Mass Spec Standard
PH302436

USD 2,055.00

3 Weeks

CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407)

Tag C-Myc/DDK
Expression Host HEK293
CK1 epsilon (CSNK1E) (NM_001894) Human Mass Spec Standard
PH321884

USD 2,055.00

3 Weeks

CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885)

Tag C-Myc/DDK
Expression Host HEK293
CK1 epsilon (CSNK1E) Rabbit Polyclonal Antibody
TA349647

USD 345.00

In Stock

Rabbit Polyclonal Anti-CSNK1E Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human CSNK1E
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5D4]
TA803799

USD 379.00

In Stock

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5D4]
TA803799AM

USD 420.00

4 Weeks

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4), Biotinylated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI5D4]
TA803799BM

USD 420.00

4 Weeks

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4), HRP conjugated

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation HRP
CK1 epsilon (CSNK1E) Mouse Monoclonal Antibody [Clone ID: OTI5D4]
TA803799S

USD 159.00

2 Days

CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated