Products

cDNA Clones (25)
Antibodies (14)
Proteins (11)
Jump to Filters
View as table Download
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone
RC219136

USD 470.00

In Stock

PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone
RG219136

USD 520.00

In Stock

PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Lentiviral Particle
RC219136L1V

USD 870.00

3 Weeks

Lenti ORF particles, PPP3CA (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130692) Human Tagged ORF Clone
RC225795

USD 440.00

In Stock

PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone
RC219136L3

USD 670.00

3 Weeks

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Lentiviral Particle
RC219136L3V

USD 870.00

7 Weeks

Lenti ORF particles, PPP3CA (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone
RC219136L4

USD 670.00

In Stock

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone Lentiviral Particle
RC219136L4V

USD 870.00

3 Weeks

Lenti ORF particles, PPP3CA (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130692) Human Tagged ORF Clone
RC225795L3

USD 640.00

3 Weeks

Lenti-ORF clone of PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130692) Human Tagged ORF Clone Lentiviral Particle
RC225795L3V

USD 840.00

6 Weeks

Lenti ORF particles, PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130692) Human Tagged ORF Clone
RC225795L4

USD 640.00

3 Weeks

Lenti-ORF clone of PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130692) Human Tagged ORF Clone Lentiviral Particle
RC225795L4V

USD 840.00

6 Weeks

Lenti ORF particles, PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130691) Human Tagged ORF Clone
RC225881

USD 540.00

3 Weeks

PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin A (PPP3CA) (NM_001130691) Human Tagged ORF Clone
RC225881L3

USD 740.00

8 Weeks

Lenti-ORF clone of PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130691) Human Tagged ORF Clone Lentiviral Particle
RC225881L3V

USD 940.00

11 Weeks

Lenti ORF particles, PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130691) Human Tagged ORF Clone
RC225881L4

USD 740.00

8 Weeks

Lenti-ORF clone of PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130691) Human Tagged ORF Clone Lentiviral Particle
RC225881L4V

USD 940.00

11 Weeks

Lenti ORF particles, PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Calcineurin A (PPP3CA) (NM_001130692) Human Tagged ORF Clone
RG225795

USD 480.00

3 Weeks

PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin A (PPP3CA) (NM_001130691) Human Tagged ORF Clone
RG225881

USD 590.00

3 Weeks

PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA326907

USD 275.00

3 Weeks

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone
RC219136L2

USD 670.00

In Stock

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Calcineurin A (PPP3CA) (NM_000944) Human Tagged ORF Clone
RC219136L1

USD 670.00

In Stock

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Calcineurin A (PPP3CA) (NM_000944) Human Untagged Clone
SC310299

USD 880.00

In Stock

PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Calcineurin A (PPP3CA) Mouse Monoclonal Antibody [Clone ID: CC-6]
AM20596PU-N

USD 405.00

2 Weeks

Calcineurin A (PPP3CA) mouse monoclonal antibody, clone CC-6, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
AP05049PU-N

USD 360.00

5 Days

Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH
Calcineurin A (PPP3CA) Sheep Polyclonal Antibody
AP05059PU-N

USD 360.00

5 Days

Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A purified peptide conjugated to KLH
Calcineurin A (PPP3CA) (N-term) Rabbit Polyclonal Antibody
AP31352PU-N

USD 440.00

2 Weeks

Calcineurin A (PPP3CA) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human Calcineurin (PPP3CA).
Calcineurin A (PPP3CA) (NM_001130691) Human Untagged Clone
SC325147

USD 760.00

2 Weeks

PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA326450

USD 385.00

5 Days

Rabbit Polyclonal Anti-Calcineurin A Antibody

Reactivities Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Calcineurin A peptide (AA 364-283)
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA339197

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA339198

USD 375.00

5 Days

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE
PPP3CA / Calcineurin A (1-511, His-tag) Human Protein
AR09801PU-N

USD 845.00

2 Weeks

PPP3CA / Calcineurin A (1-511, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PPP3CA / Calcineurin A (1-511, His-tag) Human Protein
AR09801PU-S

USD 330.00

2 Weeks

PPP3CA / Calcineurin A (1-511, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli
Calcineurin A (PPP3CA) Mouse Monoclonal Antibody [Clone ID: OTI5C6]
CF810584

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PPP3CA mouse monoclonal antibody,clone OTI5C6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Calcineurin A (PPP3CA) (NM_001130692) Human Untagged Clone
SC325969

USD 790.00

3 Weeks

PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pCMV6 series
Tag Tag Free
Calcineurin A (PPP3CA) Rabbit Polyclonal Antibody
TA349733

USD 345.00

In Stock

Rabbit Polyclonal Anti-PPP3CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA
Calcineurin A (PPP3CA) ICC Control Block
TB419136

USD 1,120.00

4 Weeks

Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Calcineurin A (PPP3CA) ICC Control Block
TB425795

USD 1,090.00

4 Weeks

Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Calcineurin A (PPP3CA) ICC Control Block
TB425881

USD 1,190.00

4 Weeks

Transient overexpression of PPP3CA (NM_001130691) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Calcineurin A (PPP3CA) (NM_000944) Human Recombinant Protein
TP762295

USD 205.00

2 Weeks

Purified recombinant protein of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Ser2-Gly105, with N-terminal His-ABP tag, expressed in E.coli, 50ug

Tag N-His ABP
Expression Host E. coli
Calcineurin A (PPP3CA) Cytosection
TS419136

USD 225.00

4 Weeks

Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Calcineurin A (PPP3CA) Cytosection
TS419136P5

USD 889.00

4 Weeks

Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Calcineurin A (PPP3CA) Cytosection
TS425795

USD 225.00

4 Weeks

Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Calcineurin A (PPP3CA) Cytosection
TS425795P5

USD 889.00

4 Weeks

Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Calcineurin A (PPP3CA) ICC Control Sections
TS425881P5

USD 889.00

4 Weeks

Transient overexpression of PPP3CA (NM_001130691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack