Germany
Japan
United Kingdom
China
Recombinant protein of human ligase I, DNA, ATP-dependent (LIG1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table Download
LIG1 (Myc-DDK-tagged)-Human ligase I, DNA, ATP-dependent (LIG1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
LIG1 (GFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, LIG1 (Myc-DDK tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, LIG1 (mGFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human ligase I, DNA, ATP-dependent (LIG1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, LIG1 (Myc-DDK tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ligase I, DNA, ATP-dependent (LIG1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, LIG1 (mGFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
LIG1 (myc-DDK-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LIG1 (myc-DDK-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LIG1 (untagged)-Human ligase I, DNA, ATP-dependent (LIG1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human ligase I, DNA, ATP-dependent (LIG1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
LIG1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DNA Ligase I (LIG1) (N-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of Human DNA ligase 1 |
Goat Anti-LIG1 / DNA ligase I Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-RVREDKQPEQATTS, from the internal region (near C-Terminus) of the protein sequence according to NP_000225.1. |
Rabbit Polyclonal Anti-LIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: ALEGGEVKIFSRNQEDNTGKYPDIISRIPKIKLPSVTSFILDTEAVAWDR |
Rabbit Polyclonal Anti-LIG1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-LIG1 Antibody: synthetic peptide directed towards the middle region of human LIG1. Synthetic peptide located within the following region: PSVTSFILDTEAVAWDREKKQIQPFQVLTTRKRKEVDASEIQVQVCLYAF |
Transient overexpression lysate of ligase I, DNA, ATP-dependent (LIG1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LIG1 MS Standard C13 and N15-labeled recombinant protein (NP_000225)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
LIG1 (GFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LIG1 (GFP-tagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LIG1 (untagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LIG1 (untagged) - Human ligase I, DNA, ATP-dependent (LIG1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression of LIG1 (NM_000234) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LIG1 (NM_001289064) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LIG1 (NM_001289063) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of LIG1 (NM_000234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of LIG1 (NM_000234) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LIG1 (NM_001289064) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of LIG1 (NM_001289063) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- LIG1
Pathways
- Mismatch repair