Germany
Japan
United Kingdom
China
RIPK2 (Myc-DDK-tagged)-Human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, RIPK2 (Myc-DDK tagged) - Human receptor-interacting serine-threonine kinase 2 (RIPK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, RIPK2 (mGFP-tagged) - Human receptor-interacting serine-threonine kinase 2 (RIPK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
RIPK2 (GFP-tagged) - Human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human receptor-interacting serine-threonine kinase 2 (RIPK2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, RIPK2 (Myc-DDK tagged) - Human receptor-interacting serine-threonine kinase 2 (RIPK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, RIPK2 (mGFP-tagged) - Human receptor-interacting serine-threonine kinase 2 (RIPK2), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RIPK2 (untagged)-Human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit polyclonal RIPK2 (Ser176) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
| Modifications | Phospho-specific |
Lenti ORF clone of Human receptor-interacting serine-threonine kinase 2 (RIPK2), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit anti-RIPK2 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human RIPK2 |
RIPK2 (untagged)-Human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of receptor-interacting serine-threonine kinase 2 (RIPK2)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal RIPK2 (Ab-176) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human RIPK2 around the phosphorylation site of serine 176 (S-L-SP-Q-S). |
RIPK2 (untagged)-Kinase deficient mutant (K47M) of Human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Phospho-RIPK2(Ser176) Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Phospho-RIPK2(Ser176) Antibody: A synthesized peptide derived from human RIPK2 around the phosphorylation site of Sersine 176 |
| Modifications | Phospho-specific |
Lenti ORF clone of Human receptor-interacting serine-threonine kinase 2 (RIPK2), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
RIPK2 (untagged)-Kinase deficient mutant (K47M) of Human receptor-interacting serine-threonine kinase 2 (RIPK2)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal RICK Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | RICK antibody was raised against a peptide corresponding to 20 amino acids near the amino terminus of human RICK. The immunogen is located within the first 50 amino acids of RICK. |
RIPK2 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-RIPK2 Antibody
| Applications | IF, WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RIPK2 antibody: synthetic peptide directed towards the middle region of human RIPK2. Synthetic peptide located within the following region: LRQERKRPLLDLHIELNGYMYDWNSRVSAKEKYYVWLQHTLRKKLILSYT |
RIPK2 MS Standard C13 and N15-labeled recombinant protein (NP_003812)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Transient overexpression of RIPK2 (NM_003821) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of RIPK2 (NM_003821) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of RIPK2 (NM_003821) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- RIPK2
Pathways
- NOD-like receptor signaling pathway