Products

cDNA Clones (32)
Proteins (31)
Antibodies (13)
Jump to Filters
View as table Download
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651

USD 98.00

USD 560.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_013952) Human Tagged ORF Clone
RC214129

USD 420.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_013953) Human Tagged ORF Clone
RC214188

USD 420.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8D

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_013992) Human Tagged ORF Clone
RC215690

USD 420.00

In Stock

PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8E

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L1V

USD 820.00

3 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L2V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone
RG200651

USD 460.00

In Stock

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651L4

USD 620.00

In Stock

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L3V

USD 820.00

5 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_003466) Human Tagged ORF Clone Lentiviral Particle
RC200651L4V

USD 820.00

3 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone
RC214129L3

USD 620.00

3 Weeks

Lenti-ORF clone of PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone Lentiviral Particle
RC214129L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone
RC214129L4

USD 620.00

3 Weeks

Lenti-ORF clone of PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone Lentiviral Particle
RC214129L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone
RC214188L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone Lentiviral Particle
RC214188L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone
RC214188L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013953) Human Tagged ORF Clone Lentiviral Particle
RC214188L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone
RC215690L3

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone Lentiviral Particle
RC215690L3V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone
RC215690L4

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013992) Human Tagged ORF Clone Lentiviral Particle
RC215690L4V

USD 820.00

6 Weeks

Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
PAX8 (NM_013952) Human Tagged ORF Clone
RG214129

USD 460.00

3 Weeks

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8C

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_013953) Human Tagged ORF Clone
RG214188

USD 460.00

3 Weeks

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_013992) Human Tagged ORF Clone
RG215690

USD 460.00

3 Weeks

PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
PAX8 (NM_003466) Human Untagged Clone
SC122658

USD 310.00

In Stock

PAX8 (untagged)-Human paired box 8 (PAX8), transcript variant PAX8A

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
PAX8 (NM_003466) Human Over-expression Lysate
LY401173

USD 396.00

In Stock

Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651L1

USD 768.00

In Stock

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
PAX8 Rabbit Polyclonal Antibody
TA308698

USD 415.00

5 Days

Rabbit polyclonal antibody to PAX8CC (paired box 8)

Applications Assay, IF, IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8
PAX8 Rabbit Polyclonal Antibody
TA321580

USD 345.00

In Stock

Anti-PAX8 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 250 amino acids of human paired box 8
PAX8 Rabbit Polyclonal Antibody
TA346519

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX8 antibody is: synthetic peptide directed towards the middle region of Human PAX8. Synthetic peptide located within the following region: YSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFS
PAX8 Rabbit Polyclonal Antibody
TA346520

USD 475.00

5 Days

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the N terminal of human PAX8. Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD
PAX8 (NM_003466) Human Tagged ORF Clone
RC200651L2

USD 620.00

3 Weeks

Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
PAX8 Rabbit Polyclonal Antibody
AP20584PU-N

USD 370.00

2 Weeks

PAX8 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat
PAX8 (NM_003466) Human Over-expression Lysate
LC401173

USD 121.00

In Stock

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
PAX8 (NM_013952) Human Over-expression Lysate
LC415550

USD 121.00

In Stock

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX8 (NM_013992) Human Over-expression Lysate
LC415574

USD 121.00

In Stock

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX8 (NM_013992) Human Over-expression Lysate
LC429402

USD 121.00

In Stock

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX8 Rabbit Polyclonal Antibody
TA337290

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX8 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8. Synthetic peptide located within the following region: SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW
PAX8 Mouse Monoclonal Antibody [Clone ID: B1C1]
TA354819

USD 355.00

5 Days

Mouse anti PAX8 Monoclonal Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
PAX8 Rabbit Polyclonal Antibody
TA354874

USD 355.00

5 Days

Rabbit anti PAX8 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide derived from internal sequence of human PAX8. It is identical to human, rat, and mouse
PAX8 (Center) Rabbit Polyclonal Antibody
AP17623PU-N

USD 450.00

2 Weeks

PAX8 (Center) rabbit polyclonal antibody

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human PAX8
PAX8 (1-287, His-tag) Human Protein
AR51718PU-S

USD 415.00

2 Weeks

PAX8 (1-287, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
PAX8 Goat Polyclonal Antibody
TA302560

USD 375.00

5 Days

Goat Polyclonal Antibody against PAX8 (internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-AQPGSDKRKMDD, from the internal region of the protein sequence according to NP_003457.1; NP_039245.1; NP_039246.1; NP_039247.1; NP_054698.1.
PAX8 Rabbit Polyclonal Antibody
TA335637

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAX8 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PAX8 Antibody is: synthetic peptide directed towards the C-terminal region of Human PAX8. Synthetic peptide located within the following region: TPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSA
PAX8 (1-287, His-tag) Human Protein
AR51718PU-N

USD 1,105.00

2 Weeks

PAX8 (1-287, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PAX8 (NM_013953) Human Over-expression Lysate
LC415551

USD 121.00

2 Weeks

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
PAX8 (NM_013953) Human Over-expression Lysate
LC429388

USD 121.00

2 Weeks

PAX8 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB