PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8A
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8A
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8D
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8E
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human paired box 8 (PAX8), transcript variant PAX8A
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8A, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (Myc-DDK-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (mGFP-tagged)-Human paired box 8 (PAX8), transcript variant PAX8C, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8D, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (Myc-DDK tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8E, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PAX8 (mGFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8C
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8D
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PAX8 (GFP-tagged) - Human paired box 8 (PAX8), transcript variant PAX8E
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PAX8 (untagged)-Human paired box 8 (PAX8), transcript variant PAX8A
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of paired box 8 (PAX8), transcript variant PAX8A
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit polyclonal antibody to PAX8CC (paired box 8)
Applications | Assay, IF, IHC, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 204 of PAX8 |
Anti-PAX8 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein corresponding to C terminal 250 amino acids of human paired box 8 |
Rabbit Polyclonal Anti-PAX8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PAX8 antibody is: synthetic peptide directed towards the middle region of Human PAX8. Synthetic peptide located within the following region: YSINGLLGIAQPGSDKRKMDDSDQDSCRLSIDSQSSSSGPRKHLRTDAFS |
Rabbit Polyclonal Anti-PAX8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the N terminal of human PAX8. Synthetic peptide located within the following region: KSLSPGHTLIPSSAVTPPESPQSDSLGSTYSINGLLGIAQPGSDKRKMDD |
Lenti ORF clone of Human paired box 8 (PAX8), transcript variant PAX8A, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
PAX8 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
PAX8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
PAX8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PAX8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PAX8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-PAX8 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PAX8 antibody: synthetic peptide directed towards the middle region of human PAX8. Synthetic peptide located within the following region: SSSGPRKHLRTDAFSQHHLEPLECPFERQHYPEAYASPSHTKGEQGERWW |
Mouse anti PAX8 Monoclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Rabbit anti PAX8 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide derived from internal sequence of human PAX8. It is identical to human, rat, and mouse |
PAX8 (Center) rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human PAX8 |
PAX8 (1-287, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
Goat Polyclonal Antibody against PAX8 (internal)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-AQPGSDKRKMDD, from the internal region of the protein sequence according to NP_003457.1; NP_039245.1; NP_039246.1; NP_039247.1; NP_054698.1. |
Rabbit Polyclonal Anti-PAX8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PAX8 Antibody is: synthetic peptide directed towards the C-terminal region of Human PAX8. Synthetic peptide located within the following region: TPSNTPLGRNLSTHQTYPVVADPHSPFAIKQETPEVSSSSSTPSSLSSSA |
PAX8 (1-287, His-tag) human recombinant protein, 0.25 mg
Tag | His-tag |
Expression Host | E. coli |
PAX8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PAX8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |