Germany
Japan
United Kingdom
China
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table Download
DDX58 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
DDX58 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DDX58 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DDX58 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DDX58 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, DDX58 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX58 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Anti-DDX58 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DDX58 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DDX58 goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DDX58 antibody was raised against synthetic peptide from human DDX58 / RIG-1 / RIG-I |
Rabbit Polyclonal Anti-DDX58 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58. Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH |
DDX58 MS Standard C13 and N15-labeled recombinant protein (NP_055129)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Rabbit Polyclonal Anti-DDX58 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DDX58 |
USD 420.00
4 Weeks
Transient overexpression of DDX58 (NM_014314) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of DDX58 (NM_014314) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of DDX58 (NM_014314) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- DDX58
Pathways
- RIG-I-like receptor signaling pathway