Germany
Japan
United Kingdom
China
Recombinant protein of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Products
View as table Download
DDX58 (Myc-DDK-tagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Ddx58 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
DDX58 (GFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, DDX58 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, DDX58 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
DDX58 (untagged)-Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
DDX58 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN417615 is the updated version of KN217615.
Ddx58 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN504409 is the updated version of KN304409.
Ddx58 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ddx58 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx58 (Myc-DDK-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx58 (mGFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx58 (GFP-tagged) - Mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, DDX58 (Myc-DDK tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, DDX58 (mGFP-tagged) - Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ddx58 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ddx58 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx58 (Myc-DDK-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ddx58 (mGFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ddx58 (GFP-tagged ORF) - Rat DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (Ddx58), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
DDX58 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
DDX58 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Anti-DDX58 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 909-925 amino acids of human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene DDX58
DDX58 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Transient overexpression lysate of DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DDX58 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human DDX58 |
DDX58 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Lenti ORF clone of Human DEAD (Asp-Glu-Ala-Asp) box polypeptide 58 (DDX58), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
DDX58 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
DDX58 goat polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human |
| Immunogen | DDX58 antibody was raised against synthetic peptide from human DDX58 / RIG-1 / RIG-I |
Rabbit Polyclonal Anti-DDX58 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-DDX58 antibody: synthetic peptide directed towards the middle region of human DDX58. Synthetic peptide located within the following region: EECHYTVLGDAFKECFVSRPHPKPKQFSSFEKRAKIFCARQNCSHDWGIH |
DDX58 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
Ddx58 - Mouse, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
DDX58 CRISPRa kit - CRISPR gene activation of human DExD/H-box helicase 58
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ddx58 CRISPRa kit - CRISPR gene activation of mouse DEAD (Asp-Glu-Ala-Asp) box polypeptide 58
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
DDX58 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
DDX58 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
DDX58 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Active filters
Target Symbol
- DDX58