Germany
Japan
United Kingdom
China
TANK (Myc-DDK-tagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human TRAF family member-associated NFKB activator (TANK), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, TANK (Myc-DDK tagged) - Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TANK (mGFP-tagged) - Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TANK (Myc-DDK tagged) - Homo sapiens TRAF family member-associated NFKB activator (TANK), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TANK (GFP-tagged) - Human TRAF family member-associated NFKB activator (TANK), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TANK (Myc-DDK tagged) - Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TANK (mGFP-tagged) - Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TANK (Myc-DDK-tagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of TANK (Myc-DDK-tagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TANK (Myc-DDK-tagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of TANK (mGFP-tagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TANK (mGFP-tagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TANK (GFP-tagged) - Human TRAF family member-associated NFKB activator (TANK), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TANK (GFP-tagged) - Homo sapiens TRAF family member-associated NFKB activator (TANK), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TANK (untagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human TRAF family member-associated NFKB activator (TANK), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TANK HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal anti-TANK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TANK antibody is: synthetic peptide directed towards the N-terminal region of Human TANK. Synthetic peptide located within the following region: ILYSDATGRRGMDKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQ |
Rabbit Polyclonal Anti-TANK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TANK antibody: synthetic peptide directed towards the C terminal of human TANK. Synthetic peptide located within the following region: KPFPNQDSDSVVLSGTDSELHIPRVCEFCQAVFPPSITSRGDFLRHLNSH |
Rabbit Polyclonal Anti-TANK Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TANK antibody: synthetic peptide directed towards the N terminal of human TANK. Synthetic peptide located within the following region: DKNIGEQLNKAYEAFRQACMDRDSAVKELQQKTENYEQRIREQQEQLSLQ |
TANK / ITRAF (Isoform "Short" ) (1-119) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
TANK / ITRAF (Isoform "Short" ) (1-119) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
TANK / ITRAF (1-425, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
TANK / ITRAF (1-425, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of TRAF family member-associated NFKB activator (TANK), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
TANK MS Standard C13 and N15-labeled recombinant protein (NP_004171)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
TANK (untagged)-Human TRAF family member-associated NFKB activator (TANK), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TANK (untagged) - Homo sapiens TRAF family member-associated NFKB activator (TANK), transcript variant 3
| Vector | pCMV6 series |
| Tag | Tag Free |
Transient overexpression of TANK (NM_004180) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TANK (NM_133484) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TANK (NM_001199135) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of TANK (NM_004180) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TANK (NM_004180) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TANK (NM_133484) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of TANK (NM_001199135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of TANK (NM_001199135) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- TANK
Pathways
- RIG-I-like receptor signaling pathway