Products

View as table Download

PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF particles, PPP3CA (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3CA (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3CA (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti-ORF clone of PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti-ORF clone of PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

PPP3CA Rabbit Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PPP3CA

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Calcineurin A (PPP3CA) mouse monoclonal antibody, clone CC-6, Aff - Purified

Applications IHC, WB
Reactivities Human, Rat

Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A peptide conjugated to KLH

Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Rat
Immunogen A purified peptide conjugated to KLH

Calcineurin A (PPP3CA) (N-term) rabbit polyclonal antibody, Purified

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human Calcineurin (PPP3CA).

PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-Calcineurin A Antibody

Reactivities Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Human Calcineurin A peptide (AA 364-283)

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL

Rabbit Polyclonal Anti-PPP3CA

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE

PPP3CA / Calcineurin A (1-511, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli

PPP3CA / Calcineurin A (1-511, His-tag) human recombinant protein, 10 µg

Tag His-tag
Expression Host E. coli

Carrier-free (BSA/glycerol-free) PPP3CA mouse monoclonal antibody,clone OTI5C6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3

Vector pCMV6 series
Tag Tag Free

Rabbit Polyclonal Anti-PPP3CA Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PPP3CA

PPP3CA mouse monoclonal antibody,clone OTI5C6

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Special Offer: Get a 15% discount on this product. Use code: "KO15".

Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Transient overexpression of PPP3CA (NM_001130691) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Purified recombinant protein of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Ser2-Gly105, with N-terminal His-ABP tag, expressed in E.coli, 50ug

Tag N-His ABP
Expression Host E. coli

Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Transient overexpression of PPP3CA (NM_001130691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack