PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 870.00
3 Weeks
Lenti ORF particles, PPP3CA (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 870.00
3 Weeks
Lenti ORF particles, PPP3CA (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 870.00
7 Weeks
Lenti ORF particles, PPP3CA (Myc-DDK tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 870.00
3 Weeks
Lenti ORF particles, PPP3CA (mGFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 840.00
6 Weeks
Lenti ORF particles, PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 840.00
6 Weeks
Lenti ORF particles, PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 940.00
11 Weeks
Lenti ORF particles, PPP3CA (Myc-DDK-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 940.00
11 Weeks
Lenti ORF particles, PPP3CA (mGFP-tagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP3CA (GFP-tagged) - Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
PPP3CA Rabbit Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PPP3CA |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti ORF clone of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Calcineurin A (PPP3CA) mouse monoclonal antibody, clone CC-6, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Rat |
Calcineurin A (PPP3CA) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A peptide conjugated to KLH |
Calcineurin A (PPP3CA) sheep polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Bovine, Human, Mouse, Rat |
Immunogen | A purified peptide conjugated to KLH |
Calcineurin A (PPP3CA) (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide between 21-51 amino acids from the N-terminal region of human Calcineurin (PPP3CA). |
PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-Calcineurin A Antibody
Reactivities | Canine, Human, Mouse, Rabbit, Rat |
Conjugation | Unconjugated |
Immunogen | Human Calcineurin A peptide (AA 364-283) |
Rabbit Polyclonal Anti-PPP3CA
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the N terminal of human PPP3CA. Synthetic peptide located within the following region: MSEPKAIDPKLSTTDRVVKAVPFPPSHRLTAKEVFDNDGKPRVDILKAHL |
Rabbit Polyclonal Anti-PPP3CA
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PPP3CA antibody: synthetic peptide directed towards the middle region of human PPP3CA. Synthetic peptide located within the following region: LPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINE |
PPP3CA / Calcineurin A (1-511, His-tag) human recombinant protein, 50 µg
Tag | His-tag |
Expression Host | E. coli |
PPP3CA / Calcineurin A (1-511, His-tag) human recombinant protein, 10 µg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PPP3CA (untagged)-Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
Rabbit Polyclonal Anti-PPP3CA Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PPP3CA |
PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
USD 420.00
4 Weeks
PPP3CA mouse monoclonal antibody,clone OTI5C6, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
PPP3CA mouse monoclonal antibody,clone OTI5C6, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PPP3CA mouse monoclonal antibody,clone OTI5C6
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of PPP3CA (NM_001130691) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Purified recombinant protein of Human protein phosphatase 3, catalytic subunit, alpha isozyme (PPP3CA), transcript variant 1, Ser2-Gly105, with N-terminal His-ABP tag, expressed in E.coli, 50ug
Tag | N-His ABP |
Expression Host | E. coli |
Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP3CA (NM_000944) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of PPP3CA (NM_001130692) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of PPP3CA (NM_001130691) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack