CSNK1E (Myc-DDK-tagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK1E (Myc-DDK-tagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CSNK1E (Myc-DDK-tagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human casein kinase 1, epsilon (CSNK1E), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, CSNK1E (Myc-DDK tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, CSNK1E (mGFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK1E (Myc-DDK tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK1E (mGFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
CSNK1E (GFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CSNK1E (GFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USD 820.00
5 Weeks
Lenti ORF particles, CSNK1E (Myc-DDK tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
3 Weeks
Lenti ORF particles, CSNK1E (mGFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, CSNK1E (Myc-DDK tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, CSNK1E (mGFP-tagged) - Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CSNK1E (untagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 1
Vector | pCMV6-AC |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal anti-CKI-e antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CKI-e. |
TPTEP2-CSNK1E rabbit polyclonal antibody, Aff - Purified
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide, corresponding to amino acids 250-350 of Human Casein Kinase Iε. |
CSNK1E (untagged)-Human casein kinase 1, epsilon (CSNK1E), transcript variant 2
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
CSNK1E (untagged)-Kinase deficient mutant (K38M) of Human casein kinase 1, epsilon (CSNK1E), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human casein kinase 1, epsilon (CSNK1E), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CSNK1E HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of casein kinase 1, epsilon (CSNK1E), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Goat Polyclonal Antibody against CSNK1E
Applications | WB |
Reactivities | Human |
Immunogen | Peptide with sequence C-PASQTSVPFDHLGK, from the C Terminus of the protein sequence according to NP_001885.1; NP_689407.1. |
Rabbit Polyclonal Anti-CSNK1E Antibody
Applications | WB |
Reactivities | Human |
Immunogen | The immunogen for anti-CSNK1E antibody: synthetic peptide directed towards the N terminal of human CSNK1E. Synthetic peptide located within the following region: MELRVGNKYRLGRKIGSGSFGDIYLGANIASGEEVAIKLECVKTKHPQLH |
Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CSNK1E HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_689407)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CSNK1E MS Standard C13 and N15-labeled recombinant protein (NP_001885)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Rabbit Polyclonal Anti-CSNK1E Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human CSNK1E |
CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CSNK1E mouse monoclonal antibody, clone OTI2B3 (formerly 2B3)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CSNK1E mouse monoclonal antibody, clone OTI5D4 (formerly 5D4)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9), Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9), HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
CSNK1E mouse monoclonal antibody, clone OTI5C9 (formerly 5C9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
CSNK1E mouse monoclonal antibody, clone OTI5H10 (formerly 5H10)
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI5H10 (formerly 5H10), Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
USD 420.00
4 Weeks
CSNK1E mouse monoclonal antibody, clone OTI5H10 (formerly 5H10), HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |