Germany
Japan
United Kingdom
China
ABHD12 (Myc-DDK-tagged)-Human abhydrolase domain containing 12 (ABHD12), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
ABHD12 (Myc-DDK-tagged)-Human abhydrolase domain containing 12 (ABHD12), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human abhydrolase domain containing 12 (ABHD12), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, ABHD12 (Myc-DDK tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ABHD12 (mGFP-tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Abhd12 (Myc-DDK-tagged) - Mouse abhydrolase domain containing 12 (Abhd12)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABHD12 (GFP-tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ABHD12 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404302 is the updated version of KN204302.
Abhd12 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN500648 is the updated version of KN300648.
Abhd12 (GFP-tagged) - Mouse abhydrolase domain containing 12 (Abhd12)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abhd12 (Myc-DDK-tagged) - Mouse abhydrolase domain containing 12 (Abhd12)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd12 (Myc-DDK-tagged) - Mouse abhydrolase domain containing 12 (Abhd12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abhd12 (mGFP-tagged) - Mouse abhydrolase domain containing 12 (Abhd12)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd12 (GFP-tagged) - Mouse abhydrolase domain containing 12 (Abhd12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 12 (ABHD12), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABHD12 (Myc-DDK tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 12 (ABHD12), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABHD12 (mGFP-tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABHD12 (Myc-DDK tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ABHD12 (mGFP-tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ABHD12 (GFP-tagged) - Human abhydrolase domain containing 12 (ABHD12), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Abhd12 (Myc-DDK-tagged ORF) - Rat abhydrolase domain containing 12 (Abhd12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Abhd12 (Myc-DDK-tagged ORF) - Rat abhydrolase domain containing 12 (Abhd12), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd12 (Myc-DDK-tagged ORF) - Rat abhydrolase domain containing 12 (Abhd12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Abhd12 (mGFP-tagged ORF) - Rat abhydrolase domain containing 12 (Abhd12), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Abhd12 (GFP-tagged ORF) - Rat abhydrolase domain containing 12 (Abhd12), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
ABHD12 (untagged)-Human abhydrolase domain containing 12 (ABHD12), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Abhd12 (untagged) - Mouse abhydrolase domain containing 12 (Abhd12), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Abhd12 (untagged ORF) - Rat abhydrolase domain containing 12 (Abhd12), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human abhydrolase domain containing 12 (ABHD12), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ABHD12 (untagged)-Human abhydrolase domain containing 12 (ABHD12), transcript variant 2
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ABHD12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 2
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-ABHD12 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ABHD12 Antibody: synthetic peptide directed towards the middle region of human ABHD12. Synthetic peptide located within the following region: CPLLILHAEDDPVVPFQLGRKLYSIAAPARSFRDFKVQFVPFHSDLGYRH |
Transient overexpression lysate of abhydrolase domain containing 12 (ABHD12), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Goat Anti-ABHD12 Antibody
| Applications | WB |
| Reactivities | Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-REFLGKSEPEHQH, from the C-Terminus of the protein sequence according to NP_001035937.1; NP_056415.1. |
Rabbit anti-ABHD12 polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide derived from Human ABHD12. |
Rabbit polyclonal anti-ABHD12 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ABHD12. |
ABHD12 CRISPRa kit - CRISPR gene activation of human abhydrolase domain containing 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Abhd12 CRISPRa kit - CRISPR gene activation of mouse abhydrolase domain containing 12
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene ABHD12
ABHD12 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Abhd12
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Abhd12
ABHD12 MS Standard C13 and N15-labeled recombinant protein (NP_001035937)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
3`UTR clone of abhydrolase domain containing 12 (ABHD12) transcript variant 2 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
3`UTR clone of abhydrolase domain containing 12 (ABHD12) transcript variant 1 for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Active filters
Target Symbol
- ABHD12