Germany
Japan
United Kingdom
China
ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, ASH2L (Myc-DDK tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ASH2L (mGFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Ash2l (Myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ash2l (GFP-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ash2l (myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (GFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN415552 is the updated version of KN215552.
Ash2l - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN501677 is the updated version of KN301677.
Lenti ORF clone of Ash2l (Myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ash2l (Myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ash2l (mGFP-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ash2l (GFP-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ash2l (Myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ash2l (Myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ash2l (Myc-DDK-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ash2l (mGFP-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ash2l (GFP-tagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (Myc-DDK tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (mGFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti-ORF clone of ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (Myc-DDK-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of ASH2L (mGFP-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ASH2L (mGFP-tagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ASH2L (Myc-DDK tagged) - Homo sapiens ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (myc-DDK-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (GFP-tagged) - Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
ASH2L (GFP-tagged) - Homo sapiens ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ash2l (Myc-DDK-tagged ORF) - Rat ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ash2l (Myc-DDK-tagged ORF) - Rat ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ash2l (Myc-DDK-tagged ORF) - Rat ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ash2l (mGFP-tagged ORF) - Rat ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ash2l (GFP-tagged ORF) - Rat ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Rabbit Polyclonal ASH2 Antibody
| Applications | ELISA, IF, WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: mouse Ash2 (absent, small, or homeotic 2), using 3 different KLH-conjugated synthetic peptides, 2 containing an amino acid sequence from the central and 1 containing an amino acid sequence from the C-terminal part of |
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Ash2l - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Ash2l (untagged) - Mouse ash2 (absent, small, or homeotic)-like (Drosophila) (Ash2l), transcript variant 1, (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-ASH2L Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2L antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: AAGAAAPPGEGISAAPTVEPSSGEAEGGEANLVDVSGGLETESSNGKDTL |
Rabbit Polyclonal ASH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: human Ash2 (absent, small, or homeotic 2), using a recombinant protein. |
Rabbit Polyclonal ASH2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ASH2 antibody: human Ash2 (absent, small, or homeotic 2), using a recombinant protein. |
ASH2L - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Lenti ORF clone of Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ASH2L (untagged)-Human ash2 (absent, small, or homeotic)-like (Drosophila) (ASH2L), transcript variant 1
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Ash2l (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
ASH2L (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the middle region of human ASH2L. Synthetic peptide located within the following region: AAGSSGKGRGAKRKQQDGGTTGTTKKARSDPLFSAQRLPPHGYPLEHPFN |
Rabbit Polyclonal Anti-ASH2L Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-ASH2L Antibody: synthetic peptide directed towards the N terminal of human ASH2L. Synthetic peptide located within the following region: EPSSGEAEGGEANLVDVSGGLETESSNGKDTLEGAGDTSEVMDTQAGSVD |
Active filters
Target Symbol
- ASH2L