Products

cDNA Clones (31)
Gene Expression (14)
RNAi (13)
Antibodies (7)
Proteins (6)
Jump to Filters
View as table Download
Chrna7 (NM_007390) Mouse Tagged ORF Clone
MR224522

USD 460.00

In Stock

Chrna7 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 7 (Chrna7)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle
RC221382L1V

USD 860.00

3 Weeks

Lenti ORF particles, CHRNA7 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle
RC221382L2V

USD 860.00

6 Weeks

Lenti ORF particles, CHRNA7 (mGFP-tagged) - Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
Chrna7 (NM_007390) Mouse Tagged ORF Clone
MG224522

USD 510.00

In Stock

Chrna7 (GFP-tagged) - Mouse cholinergic receptor nicotinic alpha polypeptide 7 (Chrna7), (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Chrna7 Mouse Gene Knockout Kit (CRISPR)
KN503310

USD 1,290.00

2 Weeks

Chrna7 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN503310 is the updated version of KN303310.
Chrna7 (NM_007390) Mouse Tagged ORF Clone
MR224522L3

USD 660.00

3 Weeks

Lenti ORF clone of Chrna7 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 7 (Chrna7)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_007390) Mouse Tagged ORF Clone Lentiviral Particle
MR224522L3V

USD 860.00

6 Weeks

Lenti ORF particles, Chrna7 (Myc-DDK-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 7 (Chrna7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_007390) Mouse Tagged ORF Clone
MR224522L4

USD 660.00

3 Weeks

Lenti ORF clone of Chrna7 (mGFP-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 7 (Chrna7)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_007390) Mouse Tagged ORF Clone Lentiviral Particle
MR224522L4V

USD 860.00

6 Weeks

Lenti ORF particles, Chrna7 (GFP-tagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 7 (Chrna7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone
RC221382L3

USD 660.00

3 Weeks

Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle
RC221382L3V

USD 860.00

5 Weeks

Lenti ORF particles, CHRNA7 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone Lentiviral Particle
RC221382L4V

USD 860.00

3 Weeks

Lenti ORF particles, CHRNA7 (mGFP-tagged) - Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_001190455) Human Tagged ORF Clone
RC231298L3

USD 690.00

3 Weeks

Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_001190455) Human Tagged ORF Clone Lentiviral Particle
RC231298L3V

USD 890.00

6 Weeks

Lenti ORF particles, CHRNA7 (Myc-DDK tagged) - Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_001190455) Human Tagged ORF Clone Lentiviral Particle
RC231298L4V

USD 890.00

6 Weeks

Lenti ORF particles, CHRNA7 (mGFP-tagged) - Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_012832) Rat Tagged ORF Clone
RR202164

USD 680.00

5 Weeks

Chrna7 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 7 (Chrna7), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Chrna7 (NM_012832) Rat Tagged ORF Clone
RR202164L3

USD 880.00

8 Weeks

Lenti ORF clone of Chrna7 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 7 (Chrna7), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_012832) Rat Tagged ORF Clone Lentiviral Particle
RR202164L3V

USD 1,100.00

12 Weeks

Lenti ORF particles, Chrna7 (Myc-DDK-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 7 (Chrna7), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_012832) Rat Tagged ORF Clone
RR202164L4

USD 960.00

8 Weeks

Lenti ORF clone of Chrna7 (mGFP-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 7 (Chrna7), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Chrna7 (NM_012832) Rat Tagged ORF Clone Lentiviral Particle
RR202164L4V

USD 1,230.00

12 Weeks

Lenti ORF particles, Chrna7 (GFP-tagged ORF) - Rat cholinergic receptor, nicotinic, alpha 7 (Chrna7), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human Tagged ORF Clone
RC221382L1

USD 816.00

In Stock

Lenti ORF clone of Human cholinergic receptor, nicotinic, alpha 7 (CHRNA7), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
Chrna7 (NM_007390) Mouse Untagged Clone
MC216944

USD 680.00

In Stock

Chrna7 (untagged) - Mouse cholinergic receptor, nicotinic, alpha polypeptide 7 (Chrna7), (10ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Chrna7 Mouse siRNA Oligo Duplex (Locus ID 11441)
SR416144

USD 430.00

In Stock

Chrna7 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).
Chrna7 Rat siRNA Oligo Duplex (Locus ID 25302)
SR501878

USD 430.00

In Stock

Chrna7 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Chrna7 Rabbit Polyclonal Antibody
TA328885

USD 585.00

3 Weeks

Rabbit Polyclonal Anti-Nicotinic Acetylcholine Receptor alpha7 (extracellular)

Applications FC, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide (C)KELVKNYNPLER, corresponding to amino acid residues 31-42 of rat nAChRa7. Extracellular, N-terminus.
Chrna7 Rat shRNA Plasmid (Locus ID 25302)
TG709449

USD 715.00

In Stock

Chrna7 - Rat, 4 unique 29mer shRNA constructs in retroviral GFP vector

Format Retroviral plasmids
Vector pGFP-V-RS
Chrna7 Mouse shRNA Plasmid (Locus ID 11441)
TL511575

USD 815.00

In Stock

Chrna7 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) Goat Polyclonal Antibody
AP22903PU-N

USD 440.00

2 Weeks

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (Internal) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC
Reactivities Bovine, Canine, Chicken, Equine, Human, Monkey, Porcine
Immunogen Synthetic peptide from an internal region of human CHRNA7 (NP_000737.1)
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Rabbit Polyclonal Antibody
TA338736

USD 310.00

2 Weeks

Rabbit Polyclonal Anti-CHRNA7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the middle region of human CHRNA7. Synthetic peptide located within the following region: VPTPDSGVVCGRMACSPTHDEHLLHGGQPPEGDPDLAKILEEVRYIANRF
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Goat Polyclonal Antibody
TA348983

USD 429.00

2 Weeks

Goat Polyclonal Anti-CHRNA7 Antibody

Reactivities Rat (Expected from sequence similarity: Human, Mouse, Dog, Cow)
Conjugation Unconjugated
Immunogen The immunogen for Anti-CHRNA7 Antibody: Peptide with sequence KRPGEDKVRPACQHKQ, from the internal region of the protein sequence according to NP_000737.1.
Chrna7 Mouse Gene Knockout Kit (CRISPR)
KN303310

USD 1,290.00

2 Weeks

Chrna7 - mouse gene knockout kit via CRISPR, HDR mediated

Format 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control
Donor DNA GFP-puro
Chrna7 Mouse qPCR Primer Pair (NM_007390)
MP202486

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Chrna7

Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) (NM_000746) Human 3' UTR Clone
SC207827

USD 560.00

4 Weeks

3`UTR clone of cholinergic receptor nicotinic alpha 7 (CHRNA7) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
Nicotinic Acetylcholine Receptor alpha 7 (CHRNA7) Rabbit Polyclonal Antibody
TA330424

USD 310.00

5 Days

Rabbit Polyclonal Anti-CHRNA7 Antibody

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-CHRNA7 antibody: synthetic peptide directed towards the N terminal of human CHRNA7. Synthetic peptide located within the following region: QGEFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQV
Chrna7 Mouse shRNA Lentiviral Particle (Locus ID 11441)
TL511575V

USD 1,395.00

3 Weeks

Chrna7 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.

Format Lentiviral particles
Vector pGFP-C-shLenti
Mouse Chrna7 activation kit by CRISPRa
GA200034

USD 1,290.00

2 Weeks

Chrna7 CRISPRa kit - CRISPR gene activation of mouse cholinergic receptor, nicotinic, alpha polypeptide 7

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector