Germany
Japan
United Kingdom
China
GALM (Myc-DDK-tagged)-Human galactose mutarotase (aldose 1-epimerase) (GALM)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human galactose mutarotase (aldose 1-epimerase) (GALM)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Galm (GFP-tagged) - Mouse galactose mutarotase (Galm)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GALM (GFP-tagged) - Human galactose mutarotase (aldose 1-epimerase) (GALM)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Galm (Myc-DDK-tagged) - Mouse galactose mutarotase (Galm)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GALM - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400995 is the updated version of KN200995.
Galm - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN506272 is the updated version of KN306272.
Lenti ORF clone of Galm (Myc-DDK-tagged) - Mouse galactose mutarotase (Galm)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Galm (Myc-DDK-tagged) - Mouse galactose mutarotase (Galm), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Galm (mGFP-tagged) - Mouse galactose mutarotase (Galm)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Galm (GFP-tagged) - Mouse galactose mutarotase (Galm), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human galactose mutarotase (aldose 1-epimerase) (GALM), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GALM (Myc-DDK tagged) - Human galactose mutarotase (aldose 1-epimerase) (GALM), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human galactose mutarotase (aldose 1-epimerase) (GALM), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, GALM (mGFP-tagged) - Human galactose mutarotase (aldose 1-epimerase) (GALM), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Galm (Myc-DDK-tagged ORF) - Rat galactose mutarotase (aldose 1-epimerase) (Galm), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Galm (Myc-DDK-tagged ORF) - Rat galactose mutarotase (aldose 1-epimerase) (Galm), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Galm (Myc-DDK-tagged ORF) - Rat galactose mutarotase (aldose 1-epimerase) (Galm), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Galm (mGFP-tagged ORF) - Rat galactose mutarotase (aldose 1-epimerase) (Galm), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Galm (GFP-tagged ORF) - Rat galactose mutarotase (aldose 1-epimerase) (Galm), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GALM rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Mutarotase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
GALM rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Porcine |
| Immunogen | Mutarotase isolated and purified from Porcine kidney. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
Galm (untagged) - Mouse galactose mutarotase (Galm), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
GALM rabbit polyclonal antibody, Serum
| Applications | ELISA, IP, WB |
| Reactivities | Porcine |
| Immunogen | Mutarotase [Porcine Kidney]. |
GALM rabbit polyclonal antibody, Biotin, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Porcine |
| Conjugation | Biotin |
| Immunogen | Mutarotase from porcine kidney |
GALM rabbit polyclonal antibody, HRP, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Porcine |
| Conjugation | HRP |
| Immunogen | Mutarotase from porcine kidney |
GALM rabbit polyclonal antibody, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Porcine |
| Immunogen | Mutarotase from porcine kidney |
Transient overexpression lysate of galactose mutarotase (aldose 1-epimerase) (GALM)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
GALM (untagged)-Human galactose mutarotase (aldose 1-epimerase) (GALM)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit Polyclonal Anti-GALM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GALM antibody: synthetic peptide directed towards the N terminal of human GALM. Synthetic peptide located within the following region: WGCTITALEVKDRQGRASDVVLGFAELEGYLQKQPYFGAVIGRVANRIAK |
Rabbit Polyclonal Anti-GALM Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GALM antibody: synthetic peptide directed towards the middle region of human GALM. Synthetic peptide located within the following region: SKEKHFCARVHHAASGRVLEVYTTQPGVQFYTGNFLDGTLKGKNGAVYPK |
Aldose 1-epimerase (1-342, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Aldose 1-epimerase (1-342, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
GALM CRISPRa kit - CRISPR gene activation of human galactose mutarotase
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene GALM
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Homo sapiens gene GALM
GALM HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Galm
| Application | Plasmid of exact quantity for transcript copy number calculation |
qSTAR qPCR primer pairs against Mus musculus gene Galm
GALM MS Standard C13 and N15-labeled recombinant protein (NP_620156)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Galm (untagged ORF) - Rat galactose mutarotase (aldose 1-epimerase) (Galm), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of galactose mutarotase (aldose 1-epimerase) (GALM) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Galm (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
GALM rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human GALM |
GALM Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-342 of human GALM (NP_620156.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- GALM