Germany
Japan
United Kingdom
China
LGALS1 (Myc-DDK-tagged)-Human lectin, galactoside-binding, soluble, 1 (LGALS1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lgals1 (Myc-DDK-tagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LGALS1 (GFP-tagged) - Human lectin, galactoside-binding, soluble, 1 (LGALS1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
LGALS1 (untagged)-Human lectin, galactoside-binding, soluble, 1 (LGALS1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human lectin, galactoside-binding, soluble, 1 (LGALS1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, LGALS1 (Myc-DDK tagged) - Human lectin, galactoside-binding, soluble, 1 (LGALS1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lgals1 (GFP-tagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human lectin, galactoside-binding, soluble, 1 (LGALS1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lgals1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN509240 is the updated version of KN309240.
Lenti ORF clone of Lgals1 (Myc-DDK-tagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lgals1 (Myc-DDK-tagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lgals1 (mGFP-tagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human lectin, galactoside-binding, soluble, 1 (LGALS1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, LGALS1 (mGFP-tagged) - Human lectin, galactoside-binding, soluble, 1 (LGALS1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lgals1 (Myc-DDK-tagged ORF) - Rat lectin, galactoside-binding, soluble, 1 (Lgals1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Lgals1 (Myc-DDK-tagged ORF) - Rat lectin, galactoside-binding, soluble, 1 (Lgals1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lgals1 (Myc-DDK-tagged ORF) - Rat lectin, galactoside-binding, soluble, 1 (Lgals1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Lgals1 (mGFP-tagged ORF) - Rat lectin, galactoside-binding, soluble, 1 (Lgals1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Lgals1 (GFP-tagged ORF) - Rat lectin, galactoside-binding, soluble, 1 (Lgals1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lgals1 (untagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
LGALS1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Lgals1 (GFP-tagged) - Mouse lectin, galactose binding, soluble 1 (Lgals1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Purified recombinant protein of Human lectin, galactoside-binding, soluble, 1 (LGALS1).
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human lectin, galactoside-binding, soluble, 1 (LGALS1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-LGALS1 Antibody - middle region
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LGALS1 antibody: synthetic peptide directed towards the middle region of human LGALS1. Synthetic peptide located within the following region: EQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYM |
qSTAR qPCR primer pairs against Mus musculus gene Lgals1
qSTAR qPCR primer pairs against Homo sapiens gene LGALS1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Transient overexpression lysate of lectin, galactoside-binding, soluble, 1 (LGALS1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
LGALS1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
SR320840 is the updated version of SR302674.
Lgals1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lgals1 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Rabbit polyclonal anti-LGALS1 antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human LGALS1. |
Lgals1 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
LGALS1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
LGALS1 - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
Lgals1 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Galectin 1 (LGALS1) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | Gst fusion protein from Human Galectin-1 |
Mouse Galectin-1 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse GALECTIN-1 |
| Reactivities | Mouse |
Goat Anti-Lgals1 / galectin-1 (aa100-112) Antibody
| Applications | WB |
| Reactivities | Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-KLPDGHEFKFPNR, from the internal region of the protein sequence according to NP_032521.1. |
LGALS1 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Lgals1 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
LGALS1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Galectin-1 (1-135) human recombinant protein, 0.5 mg
| Expression Host | E. coli |
Galectin-1 (1-135) human recombinant protein, 0.1 mg
| Expression Host | E. coli |
Galectin-1 human recombinant protein, 50 µg
| Expression Host | E. coli |
Galectin-1 (1-135, His-tag) mouse protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
Galectin-1 (1-135, His-tag) mouse protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) LGALS1 mouse monoclonal antibody,clone OTI1E2
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
For quantitative detection of human Galectin-1 in cell culture supernates, cell lysates, serum and plasma (heparin, EDTA).
| Assay Type | Sandwich ELISA kit of Quantitative Detection for human Galectin-1 |
| Format | 8x12 divisible strips |
| Reactivities | Human |
Active filters
Target Symbol
- LGALS1