Germany
Japan
United Kingdom
China
MMP3 (Myc-DDK-tagged)-Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
MMP3 (untagged)-Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3)
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Recombinant protein of human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Mmp3 (Myc-DDK-tagged) - Mouse matrix metallopeptidase 3 (Mmp3)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, MMP3 (Myc-DDK tagged) - Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, MMP3 (mGFP-tagged) - Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
MMP3 (GFP-tagged) - Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Mmp3 (GFP-tagged) - Mouse matrix metallopeptidase 3 (Mmp3)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
MMP3 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN410235 is the updated version of KN210235.
Mmp3 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN510182 is the updated version of KN310182.
Lenti ORF particles, Mmp3 (Myc-DDK-tagged) - Mouse matrix metallopeptidase 3 (Mmp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mmp3 (mGFP-tagged) - Mouse matrix metallopeptidase 3 (Mmp3)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mmp3 (GFP-tagged) - Mouse matrix metallopeptidase 3 (Mmp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MMP3 (Myc-DDK tagged) - Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, MMP3 (mGFP-tagged) - Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Mmp3 (Myc-DDK-tagged ORF) - Rat matrix metallopeptidase 3 (Mmp3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Mmp3 (Myc-DDK-tagged ORF) - Rat matrix metallopeptidase 3 (Mmp3), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mmp3 (Myc-DDK-tagged ORF) - Rat matrix metallopeptidase 3 (Mmp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Mmp3 (mGFP-tagged ORF) - Rat matrix metallopeptidase 3 (Mmp3), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Mmp3 (GFP-tagged ORF) - Rat matrix metallopeptidase 3 (Mmp3), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
qSTAR qPCR primer pairs against Homo sapiens gene MMP3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: SFAVREHGDFYPFDGPGNVLAHAYAPGPGINGDAHFDDDEQWTKDTTGTN |
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 antibody: synthetic peptide directed towards the middle region of human MMP3. Synthetic peptide located within the following region: AEDFPGIDSKIDAVFEEFGFFYFFTGSSQLEFDPNAKKVTHTLKSNSWLN |
Mmp3 (untagged) - Mouse matrix metallopeptidase 3 (Mmp3), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Mmp3 (Myc-DDK-tagged) - Mouse matrix metallopeptidase 3 (Mmp3)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Purified recombinant protein of Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3).
| Tag | Tag Free |
| Expression Host | E. coli |
qSTAR qPCR primer pairs against Mus musculus gene Mmp3
Mmp3 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
MMP3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Rabbit Polyclonal Anti-MMP3 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MMP3 Antibody: A synthesized peptide derived from human MMP3 |
MMP3 rabbit polyclonal antibody, Immunoaffinity purified
| Applications | ICC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Carrier-protein conjugated synthetic peptide encompassing a sequence within the N-terminus region of human MMP3. The exact sequence is proprietary. |
Human MMP-3 ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human MMP-3 |
| Reactivities | Human |
MMP3 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Mmp3 (untagged ORF) - Rat matrix metallopeptidase 3 (Mmp3), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal MMP3 (Cleaved-Phe100) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from human MMP3. |
MMP3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
qPCR primer pairs and template standards against Homo sapiens gene MMP3
| Application | Plasmid of exact quantity for transcript copy number calculation |
MMP3 Rabbit Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human MMP3 |
Purified recombinant protein of Human matrix metallopeptidase 3 (stromelysin 1, progelatinase) (MMP3), Leu246-End, with N-terminal His tag, expressed in E.coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Mmp3 - mouse gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
Active filters
Target Symbol
- MMP3