Germany
Japan
United Kingdom
China
PPIL1 (Myc-DDK-tagged)-Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
PPIL1 (GFP-tagged) - Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
PPIL1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN400015 is the updated version of KN200015.
Ppil1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN513700 is the updated version of KN313700.
Ppil1 (GFP-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppil1 (GFP-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ppil1 (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppil1 (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppil1 (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppil1 (mGFP-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppil1 (GFP-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ppil1 (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppil1 (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppil1 (Myc-DDK-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppil1 (mGFP-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppil1 (GFP-tagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPIL1 (Myc-DDK tagged) - Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, PPIL1 (mGFP-tagged) - Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ppil1 (Myc-DDK-tagged ORF) - Rat peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ppil1 (Myc-DDK-tagged ORF) - Rat peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppil1 (Myc-DDK-tagged ORF) - Rat peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ppil1 (mGFP-tagged ORF) - Rat peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ppil1 (GFP-tagged ORF) - Rat peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
PPIL1 (1-166, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
PPIL1 (1-166, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
Transient overexpression lysate of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
PPIL1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Ppil1 (untagged) - Mouse peptidylprolyl isomerase (cyclophilin)-like 1 (cDNA clone MGC:66761 IMAGE:5715252), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Ppil1
Rabbit Polyclonal Anti-PPIL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PPIL1 antibody is: synthetic peptide directed towards the N-terminal region of Human PPIL1. Synthetic peptide located within the following region: YWKHAPKTCKNFAELARRGYYNGTKFHRIIKDFMIQGGDPTGTGRGGASI |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI2F1 (formerly 2F1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI4C2 (formerly 4C2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI8F8 (formerly 8F8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PPIL1 mouse monoclonal antibody, clone OTI6H2 (formerly 6H2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PPIL1 CRISPRa kit - CRISPR gene activation of human peptidylprolyl isomerase like 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene PPIL1
PPIL1 MS Standard C13 and N15-labeled recombinant protein (NP_057143)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ppil1 (untagged ORF) - Rat peptidylprolyl isomerase (cyclophilin)-like 1 (Ppil1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
PPIL1 (untagged)-Human peptidylprolyl isomerase (cyclophilin)-like 1 (PPIL1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
PPIL1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Ppil1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Ppil1 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Active filters
Target Symbol
- PPIL1