Germany
Japan
United Kingdom
China
TNFRSF11B (Myc-DDK-tagged)-Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Tnfrsf11b (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF11B (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFRSF11B (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TNFRSF11B (GFP-tagged) - Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfrsf11b - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517975 is the updated version of KN317975.
Tnfrsf11b (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfrsf11b (mGFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf11b (GFP-tagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
5 Weeks
Lenti ORF particles, TNFRSF11B (Myc-DDK tagged) - Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
USD 820.00
3 Weeks
Lenti ORF particles, TNFRSF11B (mGFP-tagged) - Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tnfrsf11b (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 11b (Tnfrsf11b), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfrsf11b (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 11b (Tnfrsf11b), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf11b (Myc-DDK-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 11b (Tnfrsf11b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf11b (mGFP-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 11b (Tnfrsf11b), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfrsf11b (GFP-tagged ORF) - Rat tumor necrosis factor receptor superfamily, member 11b (Tnfrsf11b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tnfrsf11b - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Tnfrsf11b - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol (34 ug/ml) |
| Mammalian Cell Selection | Puromycin |
TNFRSF11B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Lenti ORF particles, Tnfrsf11b (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfrsf11b (Myc-DDK-tagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B).
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TNFRSF11B (untagged)-Human tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (cDNA clone MGC:29565 IMAGE:4875170), complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Human OPG ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Human OPG |
| Reactivities | Human |
qSTAR qPCR primer pairs against Homo sapiens gene TNFRSF11B
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
USD 457.00
5 Days
Osteoprotegerin (TNFRSF11B) rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide |
TNFRSF11B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Tnfrsf11b (untagged) - Mouse tumor necrosis factor receptor superfamily, member 11b (osteoprotegerin) (Tnfrsf11b), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Tnfrsf11b
Lenti ORF clone of Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TNFRSF11B (untagged)-Human tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit polyclonal anti-TR11B antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human TR11B. |
Rabbit Polyclonal Osteoprotegerin Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | DNA immunization. This antibody is specific for the C Terminus Region of the target protein. |
TNFRSF11B - Human, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
| E. coli Selection | Kanamycin |
| Mammalian Cell Selection | Puromycin |
TNFRSF11B - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of tumor necrosis factor receptor superfamily, member 11b (TNFRSF11B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Osteoprotegerin (TNFRSF11B) goat polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Purified recombinant Human Osteoprotegerin |
Osteoprotegerin (TNFRSF11B) goat polyclonal antibody, Aff - Purified
| Applications | ELISA |
| Reactivities | Human |
| Immunogen | Purified recombinant Human Osteoprotegerin |
Rabbit polyclonal anti-TNFRSF11B (OPG) antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E. coli-expressed recombinant human OPG |
Rabbit Polyclonal Anti-TNFRSF11B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TNFRSF11B antibody: synthetic peptide directed towards the N terminal of human TNFRSF11B. Synthetic peptide located within the following region: LDISIKWTTQETFPPKYLHYDEETSHQLLCDKCPPGTYLKQHCTAKWKTV |
Osteoprotegerin / TNFRSF11B (22-401, His-tag) human recombinant protein, 0.15 mg
| Tag | His-tag |
| Expression Host | Insect |
Osteoprotegerin / TNFRSF11B (22-401, His-tag) human recombinant protein, 30 µg
| Tag | His-tag |
| Expression Host | Insect |
Osteoprotegerin / TNFRSF11B (22-401, His-tag) mouse protein, 0.25 mg
| Tag | His-tag |
Osteoprotegerin / TNFRSF11B (22-401, His-tag) mouse protein, 50 µg
| Tag | His-tag |
Mouse OPG ELISA Kit
| Assay Type | Sandwich ELISA kit of Quantitative Detection for Mouse OPG |
| Reactivities | Mouse |
Active filters
Target Symbol
- TNFRSF11B