Germany
Japan
United Kingdom
China
XRCC1 (Myc-DDK-tagged)-Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
XRCC1 (GFP-tagged) - Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, XRCC1 (Myc-DDK tagged) - Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, XRCC1 (mGFP-tagged) - Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Xrcc1 (GFP-tagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
XRCC1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN404952 is the updated version of KN204952.
Xrcc1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519520 is the updated version of KN319520.
Xrcc1 (Myc-DDK-tagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, Xrcc1 (Myc-DDK-tagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Xrcc1 (mGFP-tagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Xrcc1 (GFP-tagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, XRCC1 (Myc-DDK tagged) - Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, XRCC1 (mGFP-tagged) - Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
XRCC1 Mutant (V72A), Myc-DDK-tagged ORF clone of Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1) as transfection-ready DNA
| Mutation | V72A |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRCC1 Mutant (R194W), Myc-DDK-tagged ORF clone of Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1) as transfection-ready DNA
| Mutation | R194W |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRCC1 Mutant (R280H), Myc-DDK-tagged ORF clone of Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1) as transfection-ready DNA
| Mutation | R280H |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
XRCC1 Mutant (R399Q), Myc-DDK-tagged ORF clone of Homo sapiens X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1) as transfection-ready DNA
| Mutation | R399Q |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Xrcc1 (Myc-DDK-tagged ORF) - Rat X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Xrcc1 (Myc-DDK-tagged ORF) - Rat X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Xrcc1 (Myc-DDK-tagged ORF) - Rat X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Xrcc1 (mGFP-tagged ORF) - Rat X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Xrcc1 (GFP-tagged ORF) - Rat X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
XRCC1 (untagged)-Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Xrcc1 (Myc-DDK-tagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
qSTAR qPCR primer pairs against Homo sapiens gene XRCC1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
XRCC1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
XRCC1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Rabbit polyclonal XRCC1 Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This XRCC1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 407-435 amino acids from the Central region of human XRCC1. |
Rabbit Polyclonal Anti-XRCC1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-XRCC1 Antibody: A synthesized peptide derived from human XRCC1 |
Xrcc1 (untagged) - Mouse X-ray repair complementing defective repair in Chinese hamster cells 1 (Xrcc1), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human X-ray repair complementing defective repair in Chinese hamster cells 1 (XRCC1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
XRCC1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
XRCC1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human XRCC1 (NP_006288.2). |
| Modifications | Unmodified |
XRCC1 Rabbit polyclonal Antibody
| Applications | ICC/IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-320 of human XRCC1 (NP_006288.2). |
| Modifications | Unmodified |
Rabbit Polyclonal Anti-XRCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-XRCC1 antibody is: synthetic peptide directed towards the C-terminal region of Human XRCC1. Synthetic peptide located within the following region: GDTEDELRRVAEQKEHRLPPGQEENGEDPYAGSTDENTDSEEHQEPPDLP |
Mouse Monoclonal XRCC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Xrcc1 - Mouse, 4 unique 29mer shRNA constructs in retroviral GFP vector
| Format | Retroviral plasmids |
| Vector | pGFP-V-RS |
Carrier-free (BSA/glycerol-free) XRCC1 mouse monoclonal antibody, clone OTI2H8 (formerly 2H8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
XRCC1 CRISPRa kit - CRISPR gene activation of human X-ray repair cross complementing 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Active filters
Target Symbol
- XRCC1