Germany
Japan
United Kingdom
China
YWHAH (Myc-DDK-tagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Ywhah (Myc-DDK-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (cDNA clone MGC:5765
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ywhah (Myc-DDK-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 1,020.00
2 Weeks
Lenti ORF particles, YWHAH (Myc-DDK tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
-
USD 1,020.00
5 Weeks
Lenti ORF particles, YWHAH (mGFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
-
YWHAH (GFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ywhah - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN519574 is the updated version of KN319574.
Ywhah (GFP-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ywhah (GFP-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (cDNA clone MGC:5765
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ywhah (Myc-DDK-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ywhah (Myc-DDK-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ywhah (mGFP-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ywhah (GFP-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ywhah (Myc-DDK-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (cDNA clone MGC:5765
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ywhah (Myc-DDK-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (cDNA clone MGC:5765, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ywhah (mGFP-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (cDNA clone MGC:5765
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ywhah (GFP-tagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (cDNA clone MGC:5765, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,020.00
5 Weeks
Lenti ORF particles, YWHAH (Myc-DDK tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 1,020.00
2 Weeks
Lenti ORF particles, YWHAH (mGFP-tagged) - Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ywhah (Myc-DDK-tagged ORF) - Rat tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ywhah (Myc-DDK-tagged ORF) - Rat tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ywhah (Myc-DDK-tagged ORF) - Rat tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ywhah (mGFP-tagged ORF) - Rat tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ywhah (GFP-tagged ORF) - Rat tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
YWHAH (untagged)-Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
YWHAH (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
14 3 3 eta (YWHAH) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide, corresponding to amino acids 50-100 of Human 14-3-3 η. |
Ywhah (untagged) - Mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (Ywhah), (10ug)
| Vector | PCMV6-Kan/Neo |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
YWHAH - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
YWHAH HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qSTAR qPCR primer pairs against Mus musculus gene Ywhah
Rabbit Polyclonal Anti-YWHAH Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-YWHAH antibody: synthetic peptide directed towards the N terminal of human YWHAH. Synthetic peptide located within the following region: ADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESKV |
qSTAR qPCR primer pairs against Homo sapiens gene YWHAH
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
14-3-3 protein eta (1-246, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
14-3-3 protein eta (1-246, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
14-3-3 protein eta (1-246) human protein, 0.5 mg
| Expression Host | E. coli |
14-3-3 protein eta (1-246) human protein, 0.1 mg
| Expression Host | E. coli |
YWHAH CRISPRa kit - CRISPR gene activation of human tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein eta
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ywhah CRISPRa kit - CRISPR gene activation of mouse tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene YWHAH
| Application | Plasmid of exact quantity for transcript copy number calculation |
Transient overexpression lysate of tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, eta polypeptide (YWHAH)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
qPCR primer pairs and template standards against Mus musculus gene Ywhah
| Application | Plasmid of exact quantity for transcript copy number calculation |
YWHAH MS Standard C13 and N15-labeled recombinant protein (NP_003396)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Active filters
Target Symbol
- YWHAH