ORF33.5 (NC_001348) Virus Tagged ORF Clone
CAT#: VC100975
- TrueORF®
Myc-DDK-tagged ORF clone of viral ORF for capsid scaffold protein [Human herpesvirus 3], codon optimized for human cell expression, YP_068407
View other clones from "Virus" (67)
Product Images
![](https://cdn.origene.com/img/defaults-img-expression-plasmids.jpg)
Specifications
Product Data | |
Type | Virus Tagged ORF Clone |
Tag | Myc-DDK |
Symbol | ORF33.5 |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>The Viral ORF clone VC100975 represents NCBI reference of YP_068407 with codon optimized for human cell expression
Red=Cloning site Blue=ORF Green=Tags(s) GACGTTGTATACGACTCCTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGCATCTGTGGCCGGCAATGCATCCAACATATCCCCCCAGCCCCCTAGTGGCGTCCCAACCGGAGGGG AGTTTGTGCTGATTCCCACAGCTTATTACAGCCAGCTCCTGACGGGCCAAACCAAGAATCCCCAAGTGTC CATCGGGGCACCAAACAACGGTCAGTACATTGTCGGCCCTTACGGCTCCCCCCACCCCCCGGCATTCCCA CCCAACACTGGAGGATATGGATGTCCCCCTGGTCATTTCGGAGGACCTTACGGCTTTCCAGGGTACCCCC CCCCAAACCGCTTGGAGATGCAGATGAGTGCCTTCATGAACGCGCTGGCTGCTGAGAGGGGGATCGATCT CCAGACTCCATGCGTTAATTTTCCCGATAAAACGGACGTTAGGAGGCCTGGCAAGCGGGACTTTAAGTCA ATGGACCAGAGGGAGCTTGACAGTTTCTACAGCGGAGAGTCTCAAATGGATGGAGAATTCCCCTCTAACA TTTACTTCCCTGGTGAGCCAACATATATAACCCACAGGCGGAGAAGAGTCTCACCCTCATATTGGCAAAG ACGCCACCGCGTGTCAAACGGCCAGCATGAAGAACTGGCTGGCGTAGTCGCAAAACTGCAGCAGGAGGTG ACAGAACTTAAAAGCCAGAACGGCACTCAGATGCCACTGTCTCACCACACCAATATCCCTGAGGGGACGA GAGACCCGCGAATTTCCATTCTCCTGAAACAACTTCAAAGCGTGTCAGGCCTCTGTAGTTCTCAAAATAC TACTAGCACACCTCACACTGATACAGTGGGACAGGACGTGAATGCTGTAGAGGCGAGCAGTAAAGCTCCC CTCATTCAAGGCTCAACCGCCGATGACGCTGATATGTTTGCAAATCAGATGATGGTGGGACGGTGT ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >VC100975 representing YP_068407
Red=Cloning sites Green=Tags MASVAGNASNISPQPPSGVPTGGEFVLIPTAYYSQLLTGQTKNPQVSIGAPNNGQYIVGPYGSPHPPAFP PNTGGYGCPPGHFGGPYGFPGYPPPNRLEMQMSAFMNALAAERGIDLQTPCVNFPDKTDVRRPGKRDFKS MDQRELDSFYSGESQMDGEFPSNIYFPGEPTYITHRRRRVSPSYWQRRHRVSNGQHEELAGVVAKLQQEV TELKSQNGTQMPLSHHTNIPEGTRDPRISILLKQLQSVSGLCSSQNTTSTPHTDTVGQDVNAVEASSKAP LIQGSTADDADMFANQMMVGRC TRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
ACCN | NC_001348 |
ORF Size | 906 bp |
OTI Disclaimer | The molecular sequence of this clone can be viewed by clicking the "ORF Nucleotide Sequence" link above. This sequence represents the NCBI reference after codon optimization for human cell expression, and retaining the same decuded protein sequence. The stop codon in the native sequence was removed to create the in-frame c-terminal fusion with a Myc-DDK tag. |
Reference Data | |
RefSeq | NC_001348.1, YP_068407 |
RefSeq ORF | 906 |
Locus ID | 4711772 |
MW | 32.8 kDa |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
VC100940 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein UL56 [Human herpesvirus 3], codon optimized for human cell expression, YP_053044 |
USD 400.00 |
|
VC100941 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein V1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040124 |
USD 400.00 |
|
VC100942 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein CIRC [Human herpesvirus 3], codon optimized for human cell expression, NP_040125 |
USD 400.00 |
|
VC100943 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL55 [Human herpesvirus 3], codon optimized for human cell expression, NP_040126 |
USD 400.00 |
|
VC100944 | Myc-DDK-tagged ORF clone of viral ORF for multifunctional expression regulator [Human herpesvirus 3], codon optimized for human cell expression, NP_040127 |
USD 580.00 |
|
VC100945 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein K [Human herpesvirus 3], codon optimized for human cell expression, NP_040128 |
USD 430.00 |
|
VC100946 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase primase subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040129 |
USD 1,720.00 |
|
VC100947 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL51 [Human herpesvirus 3], codon optimized for human cell expression, NP_040130 |
USD 400.00 |
|
VC100948 | Myc-DDK-tagged ORF clone of viral ORF for deoxyuridine triphosphatase [Human herpesvirus 3], codon optimized for human cell expression, NP_040131 |
USD 500.00 |
|
VC100949 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein N [Human herpesvirus 3], codon optimized for human cell expression, YP_068406 |
USD 400.00 |
|
VC100950 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP22 [Human herpesvirus 3], codon optimized for human cell expression, NP_040132 |
USD 400.00 |
|
VC100951 | Myc-DDK-tagged ORF clone of viral ORF for transactivating tegument protein VP16 [Human herpesvirus 3], codon optimized for human cell expression, NP_040133 |
USD 520.00 |
|
VC100953 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein VP11/12 [Human herpesvirus 3], codon optimized for human cell expression, NP_040135 |
USD 830.00 |
|
VC100954 | Myc-DDK-tagged ORF clone of viral ORF for thymidylate synthase [Human herpesvirus 3], codon optimized for human cell expression, NP_040136 |
USD 400.00 |
|
VC100956 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL43 [Human herpesvirus 3], codon optimized for human cell expression, NP_040138 |
USD 520.00 |
|
VC100957 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase processivity subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040139 |
USD 520.00 |
|
VC100958 | Myc-DDK-tagged ORF clone of viral ORF for tegument host shutoff protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040140 |
USD 590.00 |
|
VC100959 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 2 [Human herpesvirus 3], codon optimized for human cell expression, NP_040141 |
USD 400.00 |
|
VC100960 | Myc-DDK-tagged ORF clone of viral ORF for ribonucleotide reductase subunit 1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040142 |
USD 1,230.00 |
|
VC100961 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040143 |
USD 620.00 |
|
VC100962 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL37 [Human herpesvirus 3], codon optimized for human cell expression, NP_040144 |
USD 1,660.00 |
|
VC100964 | Myc-DDK-tagged ORF clone of viral ORF for small capsid protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040146 |
USD 400.00 |
|
VC100965 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress membrane protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040147 |
USD 400.00 |
|
VC100966 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL33 [Human herpesvirus 3], codon optimized for human cell expression, NP_040148 |
USD 400.00 |
|
VC100967 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging protein UL32 [Human herpesvirus 3], codon optimized for human cell expression, NP_040149 |
USD 740.00 |
|
VC100968 | Myc-DDK-tagged ORF clone of viral ORF for nuclear egress lamina protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040150 |
USD 400.00 |
|
VC100969 | Myc-DDK-tagged ORF clone of viral ORF for DNA polymerase catalytic subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040151 |
USD 1,900.00 |
|
VC100970 | Myc-DDK-tagged ORF clone of viral ORF for single-stranded DNA-binding protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040152 |
USD 1,920.00 |
|
VC100971 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 2 [Human herpesvirus 3], codon optimized for human cell expression, NP_040153 |
USD 1,230.00 |
|
VC100972 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein B [Human herpesvirus 3], codon optimized for human cell expression, NP_040154 |
USD 1,480.00 |
|
VC100973 | Myc-DDK-tagged ORF clone of viral ORF for protein V32 [Human herpesvirus 3], codon optimized for human cell expression, NP_040155 |
USD 400.00 |
|
VC100974 | Myc-DDK-tagged ORF clone of viral ORF for capsid maturation protease [Human herpesvirus 3], codon optimized for human cell expression, NP_040156 |
USD 770.00 |
|
VC100976 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL25 [Human herpesvirus 3], codon optimized for human cell expression, NP_040157 |
USD 730.00 |
|
VC100977 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL24 [Human herpesvirus 3], codon optimized for human cell expression, NP_040158 |
USD 400.00 |
|
VC100978 | Myc-DDK-tagged ORF clone of viral ORF for thymidine kinase [Human herpesvirus 3], codon optimized for human cell expression, NP_040159 |
USD 430.00 |
|
VC100979 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein H [Human herpesvirus 3], codon optimized for human cell expression, NP_040160 |
USD 1,340.00 |
|
VC100980 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL21 [Human herpesvirus 3], codon optimized for human cell expression, NP_040161 |
USD 690.00 |
|
VC100981 | Myc-DDK-tagged ORF clone of viral ORF for envelope protein UL20 [Human herpesvirus 3], codon optimized for human cell expression, NP_040162 |
USD 400.00 |
|
VC100982 | Myc-DDK-tagged ORF clone of viral ORF for major capsid protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040163 |
USD 2,210.00 |
|
VC100983 | Myc-DDK-tagged ORF clone of viral ORF for capsid triplex subunit 2 [Human herpesvirus 3], codon optimized for human cell expression, NP_040164 |
USD 400.00 |
|
VC100984 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging terminase subunit 1 [Human herpesvirus 3], codon optimized for human cell expression, NP_040165 |
USD 1,180.00 |
|
VC100985 | Myc-DDK-tagged ORF clone of viral ORF for DNA packaging tegument protein UL17 [Human herpesvirus 3], codon optimized for human cell expression, NP_040166 |
USD 1,070.00 |
|
VC100986 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL16 [Human herpesvirus 3], codon optimized for human cell expression, NP_040167 |
USD 460.00 |
|
VC100987 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL14 [Human herpesvirus 3], codon optimized for human cell expression, NP_040168 |
USD 400.00 |
|
VC100988 | Myc-DDK-tagged ORF clone of viral ORF for tegument serine/threonine protein kinase [Human herpesvirus 3], codon optimized for human cell expression, NP_040169 |
USD 650.00 |
|
VC100989 | Myc-DDK-tagged ORF clone of viral ORF for deoxyribonuclease [Human herpesvirus 3], codon optimized for human cell expression, NP_040170 |
USD 700.00 |
|
VC100990 | Myc-DDK-tagged ORF clone of viral ORF for myristylated tegument protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040171 |
USD 400.00 |
|
VC100991 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein M [Human herpesvirus 3], codon optimized for human cell expression, NP_040172 |
USD 560.00 |
|
VC100992 | Myc-DDK-tagged ORF clone of viral ORF for DNA replication origin-binding helicase [Human herpesvirus 3], codon optimized for human cell expression, NP_040173 |
USD 1,330.00 |
|
VC100993 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040174 |
USD 1,230.00 |
|
VC100994 | Myc-DDK-tagged ORF clone of viral ORF for tegument protein UL7 [Human herpesvirus 3], codon optimized for human cell expression, NP_040175 |
USD 400.00 |
|
VC100995 | Myc-DDK-tagged ORF clone of viral ORF for capsid portal protein [Human herpesvirus 3], codon optimized for human cell expression, NP_040176 |
USD 1,220.00 |
|
VC100996 | Myc-DDK-tagged ORF clone of viral ORF for helicase-primase helicase subunit [Human herpesvirus 3], codon optimized for human cell expression, NP_040177 |
USD 1,400.00 |
|
VC100997 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL4 [Human herpesvirus 3], codon optimized for human cell expression, NP_040178 |
USD 400.00 |
|
VC100998 | Myc-DDK-tagged ORF clone of viral ORF for protein V57 [Human herpesvirus 3], codon optimized for human cell expression, NP_040179 |
USD 400.00 |
|
VC100999 | Myc-DDK-tagged ORF clone of viral ORF for nuclear protein UL3 [Human herpesvirus 3], codon optimized for human cell expression, NP_040180 |
USD 400.00 |
|
VC101000 | Myc-DDK-tagged ORF clone of viral ORF for uracil-DNA glycosylase [Human herpesvirus 3], codon optimized for human cell expression, NP_040181 |
USD 400.00 |
|
VC101001 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein L [Human herpesvirus 3], codon optimized for human cell expression, NP_040182 |
USD 400.00 |
|
VC101002 | Myc-DDK-tagged ORF clone of viral ORF for ubiquitin E3 ligase ICP0 [Human herpesvirus 3], codon optimized for human cell expression, NP_040183 |
USD 600.00 |
|
VC101004 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 3], codon optimized for human cell expression, NP_040185 |
USD 400.00 |
|
VC101005 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 3], codon optimized for human cell expression, NP_040186 |
USD 400.00 |
|
VC101006 | Myc-DDK-tagged ORF clone of viral ORF for membrane protein US9 [Human herpesvirus 3], codon optimized for human cell expression, NP_040187 |
USD 400.00 |
|
VC101007 | Myc-DDK-tagged ORF clone of viral ORF for serine/threonine protein kinase US3 [Human herpesvirus 3], codon optimized for human cell expression, NP_040188 |
USD 490.00 |
|
VC101008 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein I [Human herpesvirus 3], codon optimized for human cell expression, NP_040189 |
USD 440.00 |
|
VC101009 | Myc-DDK-tagged ORF clone of viral ORF for envelope glycoprotein E [Human herpesvirus 3], codon optimized for human cell expression, NP_040190 |
USD 790.00 |
|
VC101010 | Myc-DDK-tagged ORF clone of viral ORF for virion protein US10 [Human herpesvirus 3], codon optimized for human cell expression, NP_040191 |
USD 400.00 |
|
VC101011 | Myc-DDK-tagged ORF clone of viral ORF for regulatory protein ICP22 [Human herpesvirus 3], codon optimized for human cell expression, NP_040192 |
USD 400.00 |
{0} Product Review(s)
Be the first one to submit a review