Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Asialoganglioside GM1 rabbit polyclonal antibody, Ig Fraction
| Applications | Assay, CT, FC, FN, IHC, IP |
| Reactivities | Mouse, Rat |
| Immunogen | Asialo GM1 purified from Bovine brain tissue, methylated BSA and complete Freund's adjuvant. |
DDB2 rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide corresponding to amino acids 419-427 of Human DDB2 (C-terminal) coupled to KLH |
Rabbit polyclonal antibody to MCM7 (minichromosome maintenance complex component 7)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 190 and 481 of MCM7 (Uniprot ID#P33993) |
Rabbit Polyclonal GAPDH/G3PDH Antibody
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human, Mouse, Xenopus |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide made to an internal region of human GAPDH (between residues 250 and 300)[accession number NP_002037.2] |
ROC1 (RBX1) (C-term) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | C. elegans, Human, Mouse, Zebrafish |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 94-108 of Human ROC1 (C-terminal) coupled to KLH. |
Rabbit Polyclonal antibody to c-Myc (v-myc myelocytomatosis viral oncogene homolog (avian))
| Applications | Assay, FC, IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region within amino acids 1 and 52 of c-Myc (Uniprot ID#P01106) |
Rabbit Polyclonal antibody to Histone H2A.Z (H2A histone family, member Z)
| Applications | Assay, IF, IHC, IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide contain a sequence corresponding to a region within amino acids 65 and 128 of Histone H2A.Z |
HIST4H4 (Citrulline R3) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IHC, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide derived from N-term region of Human Histone H4, containing Citrulline at position 3 |
Apc11 (ANAPC11) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | This APC11 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 76-84 of Human APC11 (C-terminal) coupled to KLH. |
Apc2 (ANAPC2) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 810-822 of Human APC2 (C-terminal) coupled to KLH. |
TIP120A (CAND1) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 11-24 of Human CAND1/TIP120A (N-terminal) coupled to KLH. |
TIP120A (CAND1) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 1130-1143 of Human CAND2/TIP120B (C-terminal) coupled to KLH. |
CDC20 (C-term) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 486-499 of Human CDC20 (fizzy) (C-terminal) coupled to KLH. |
DDB1 rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 198-213 of Human DDB1 (internal) coupled to KLH. |
PARC (CUL9) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human, Mouse |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 2503-2517 of Human PARC (C-terminus) coupled to KLH. |
Os04g0627000 (C-term) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | C. elegans, Human, Mouse, Zebrafish |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 102-113 of Human ROC2 (C-terminal) coupled to KLH. |
SKP1 (C-term) rabbit polyclonal antibody, Serum
| Applications | Assay, ELISA, IP, WB |
| Reactivities | Human |
| Immunogen | Prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 152-163 of Human SKP1 (C-terminus) coupled to KLH. |
Rabbit Polyclonal antibody to PAD4 (peptidyl arginine deiminase, type IV)
| Applications | Assay, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 326 and 611 of PAD4 (Uniprot ID#Q9UM07) |
Rabbit Polyclonal Anti-KLF2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KLF2 antibody: synthetic peptide directed towards the middle region of human KLF2. Synthetic peptide located within the following region: PPAFGLFDDAAAAAAALGLAPPAARGLLTPPASPLELLEAKPKRGRRSWP |
RAD54 (RAD54L) (1-17) rabbit polyclonal antibody, Aff - Purified
| Applications | Assay, ELISA, WB |
| Reactivities | Human |
| Immunogen | Synthetic peptide corresponding aa 1-17 of Human RAD54 protein. |
Thy1 rabbit polyclonal antibody, Serum
| Applications | Assay, CT, IHC |
| Reactivities | Mouse |
| Immunogen | CBA Brain. |
Thy1 rabbit polyclonal antibody, Serum
| Applications | Assay, CT, IHC |
| Reactivities | Mouse |
| Immunogen | CBA Brain. |
RAD9A pSer1260 rabbit polyclonal antibody, Aff - Purified
| Applications | Assay, ELISA, WB |
| Reactivities | Yeast |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1249-1263 of 1309 of yeast Rad9 protein conjugated to KLH. |
RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified
| Applications | Assay, ELISA, WB |
| Reactivities | Yeast |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to phosphorylated form of aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH. |
RAD9A pSer1129 rabbit polyclonal antibody, Aff - Purified
| Applications | Assay, ELISA, WB |
| Reactivities | Yeast |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to aa 1125-1139 of 1309 of yeast Rad9 protein conjugated to KLH. |
Glycogen synthase 1 (GYS1) pSer641 rabbit polyclonal antibody, Aff - Purified
| Applications | Assay, ELISA, WB |
| Reactivities | Human, Mouse |
| Immunogen | Human Muscle Glycogen Synthase phospho peptide corresponding to a region of the human protein conjugated to Keyhole Limpet Hemocyanin (KLH). |
Aurora B (AURKB) rabbit polyclonal antibody, Aff - Purified
| Applications | Assay, ELISA, WB |
| Reactivities | Human |
| Immunogen | This affinity purified antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding aa 227-238 of Human Aurora Kinase B protein. |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal anti-TP53 antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TP53 antibody: synthetic peptide directed towards the N terminal of human TP53. Synthetic peptide located within the following region: EEPQSDPSVEPPLSQETFSDLWKLLPENNVLSPLPSQAMDDLMLSPDDIE |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-JUN Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-JUN antibody: synthetic peptide directed towards the N terminal of human JUN. Synthetic peptide located within the following region: TAKMETTFYDDALNASFLPSESGPYGYSNPKILKQSMTLNLADPVGSLKP |
Rabbit Polyclonal Anti-TAF1 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF1 antibody: synthetic peptide directed towards the C terminal of human TAF1. Synthetic peptide located within the following region: YEVSEEEEDEEEEEQRSGPSVLSQVHLSEDEEDSEDFHSIAGDSDLDSDE |
Rabbit Polyclonal Anti-SUZ12 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-SUZ12 antibody: synthetic peptide directed towards the middle region of human SUZ12. Synthetic peptide located within the following region: TGETNDKSTAPIAKPLATRNSESLHQENKPGSVKPTQTIAVKESLTTDLQ |
Rabbit Polyclonal Anti-HDAC2 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-HDAC2 antibody: synthetic peptide directed towards the middle region of human HDAC2. Synthetic peptide located within the following region: HKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSN |
Rabbit Polyclonal Anti-MED17 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-CRSP6 Antibody: synthetic peptide directed towards the N terminal of human CRSP6. Synthetic peptide located within the following region: AAQILLKGAERLTKSVTENQENKLQRDFNSELLRLRQHWKLRKVGDKILG |
Rabbit Polyclonal Anti-SMARCA1 Antibody
| Applications | Assay, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-SMARCA1 Antibody: synthetic peptide directed towards the N terminal of human SMARCA1. Synthetic peptide located within the following region: EQDTAAVAATVAAADATATIVVIEDEQPGPSTSQEEGAAAAATEATAATE |
Active filters
Applications
- Assay
Antibody Hosts
- Rabbit
Clonalities
- Polyclonal
Filter by
Category
Target Symbol
- THY1 (3)
- CTNNB1 (2)
- HDAC2 (2)
- HDAC6 (2)
- HIST1H3A (2)
- MED6 (2)
- SMARCA1 (2)
- TAF1 (2)
- THRB (2)
- TP53 (2)
- AK6 (1)
- CTCF (1)
- EHMT2 (1)
- EZH1 (1)
- FBXO11 (1)
- GAPDH (1)
- GYS1 (1)
- H2AFZ (1)
- H2BC18 (1)
- HDAC1 (1)
- HDAC4 (1)
- JUN (1)
- KLF2 (1)
- MBD4 (1)
- MCM7 (1)
- MED17 (1)
- MED19 (1)
- MYC (1)
- PADI4 (1)
- PAX8 (1)
- PRKCG (1)
- SKP1 (1)
- SMARCA5 (1)
- SRF (1)
- SUZ12 (1)
- TAF12 (1)
- TAF6 (1)
Reactivities
Isotypes
Conjugates
Families
- Transcription Factors (26)
- Druggable Genome (25)
- Stem cell - Pluripotency (6)
- ES Cell Differentiation/IPS (4)
- Protein Kinase (3)
- Adult stem cells (1)
- Embryonic stem cells (1)
- Induced pluripotent stem cells (1)
- Nuclear Hormone Receptor (1)
- Stem cell relevant signaling - DSL/Notch pathway (1)
- Stem cell relevant signaling - JAK/STAT signaling pathway (1)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (1)
- Stem cell relevant signaling - Wnt Signaling pathway (1)
Pathways
- Pathways in cancer (11)
- Cell cycle (8)
- Wnt signaling pathway (8)
- Chronic myeloid leukemia (6)
- Colorectal cancer (6)
- MAPK signaling pathway (6)
- Thyroid cancer (6)
- Endometrial cancer (5)
- Huntington's disease (5)
- Basal cell carcinoma (4)
- Basal transcription factors (4)
- Focal adhesion (4)
- Prostate cancer (4)
- Systemic lupus erythematosus (4)
- Bladder cancer (3)
- ErbB signaling pathway (3)
- Glioma (3)
- Leukocyte transendothelial migration (3)
- Melanogenesis (3)
- Neurotrophin signaling pathway (3)
- Non-small cell lung cancer (3)
- Notch signaling pathway (3)
- Small cell lung cancer (3)
- Tight junction (3)
- Adherens junction (2)
- Amyotrophic lateral sclerosis (ALS) (2)
- Apoptosis (2)
- Arrhythmogenic right ventricular cardiomyopathy (ARVC) (2)
- Melanoma (2)
- Pancreatic cancer (2)
- Pathogenic Escherichia coli infection (2)
- TGF-beta signaling pathway (2)
- p53 signaling pathway (2)
- Acute myeloid leukemia (1)
- Alzheimer's disease (1)
- B cell receptor signaling pathway (1)
- Base excision repair (1)
- Calcium signaling pathway (1)
- DNA replication (1)
- Epithelial cell signaling in Helicobacter pylori infection (1)
- Fc gamma R-mediated phagocytosis (1)
- Gap junction (1)
- Glycolysis / Gluconeogenesis (1)
- GnRH signaling pathway (1)
- Insulin signaling pathway (1)
- Jak-STAT signaling pathway (1)
- Long-term depression (1)
- Long-term potentiation (1)
- Lysine degradation (1)
- Metabolic pathways (1)
- Natural killer cell mediated cytotoxicity (1)
- Neuroactive ligand-receptor interaction (1)
- Oocyte meiosis (1)
- Phosphatidylinositol signaling system (1)
- Renal cell carcinoma (1)
- Starch and sucrose metabolism (1)
- T cell receptor signaling pathway (1)
- Toll-like receptor signaling pathway (1)
- Ubiquitin mediated proteolysis (1)
- VEGF signaling pathway (1)
- Vascular smooth muscle contraction (1)
- Vibrio cholerae infection (1)