Rabbit anti-CXCR3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CXCR3 |
Rabbit anti-CXCR3 Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide of human CXCR3 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a 20 amino acid peptide near the amino terminus of human CX3CR1. The immunogen is located within the first 50 amino acids of CX3CR1. |
Rabbit Polyclonal CXCR4 Antibody
Applications | FC, IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a peptide corresponding to 14 amino acids near the amino terminus of human CXCR4. The immunogen is located within the first 50 amino acids of CXCR4. |
Rabbit Polyclonal CCR1 Antibody
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | This antibody was raised against a synthetic peptide of human CCR1 protein. |
CCR6 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Gorilla |
Conjugation | Unconjugated |
Immunogen | CCR6 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon (94%); Monkey (89%); Opossum (83%). |
Rabbit Polyclonal CCR3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CCR3 antibody was raised against a 14 amino acid peptide from near the carboxy terminus of human CCR3. |
CXCR4 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide, corresponding to amino acids 310-360 of Human CXCR-4. |
Rabbit Polyclonal CCR5 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR5 antibody was raised against a 15 amino acid peptide near the amino terminus of human CCR5. The immunogen is located within the first 50 amino acids of CCR5. |
Rabbit Polyclonal Anti-CXCR4 Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CXCR4 Antibody: A synthesized peptide derived from human CXCR4 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Antibody was raised against a peptide corresponding to amino acids 2 to 21 of human CX3CR1. The sequence differs from those of mouse and rat CX3CR1 by four amino acids (NP_001328). |
Rabbit polyclonal IL-8R beta/CDw128 beta (Ser347) antibody(Phospho-specific)
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-8R beta/CDw128 beta around the phosphorylation site of serine 347 (R-P-SP-F-V). |
Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CXCR4 (extracellular)
Applications | FC, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)EGISIYTSDNYTEE,corresponding to amino acid residues 2-15 of human CXCR4. Extracellular, N-terminus. |
CX3CR1 (N-term) rabbit polyclonal antibody, Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A peptide corresponding to amino acids 2-21 of Human CX3CR1. |
CCR8 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | FC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 297-325 amino acids from the C-terminal region of human CCR8 |
Rabbit Polyclonal CX3CR1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CX3CR1 antibody was raised against a peptide corresponding to amino acids in a extracellular loop of human CX3CR1. The sequence is identical to that of rat CX3CR1 and differs from that of mouse CX3CR1 by one amino acid (3,4). |
Rabbit Polyclonal Bonzo Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Bonzo antibody was raised against a peptide corresponding to amino acids near the amino terminus of human Bonzo/STRL33. The sequence of this peptide differs from those of African green monkey and pig-tailed macaque by one or two amino acids, respectively,. |
CCR6 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | CCR6 antibody was raised against synthetic 20 amino acid peptide from C-terminus of human CCR6. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Mouse, Rat, Horse (80%). |
CCR4 Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from C-terminus of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey (100%); Marmoset, Panda, Dog (94%); Hamster, Elephant, Bovine, Horse (89%); Bat, Rabbit, Opossum (83%). |
Anti-CCR3 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 10-25 amino acids of human chemokine (C-C motif) receptor 3 |
Rabbit Polyclonal Anti-CXCR1 (extracellular)
Applications | FC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide (C)SNITDPQMW DFDDLN, corresponding to aminoacid residues 2-16 of human CXCR1. Extracellular, N-terminus. |
Rabbit Polyclonal Anti-CCR4 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR4 antibody: synthetic peptide directed towards the middle region of human CCR4. Synthetic peptide located within the following region: TERNHTYCKTKYSLNSTTWKVLSSLEINILGLVIPLGIMLFCYSMIIRTL |
Rabbit Polyclonal CXCR4 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide made to a C-terminal region of the human CXCR4 protein (within residues 300-352). [Swiss-Prot P61073] |
Rabbit Polyclonal Anti-CXCR3 Antibody (C-Terminus)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CXCR3 antibody was raised against synthetic 17 amino acid peptide from C-terminus of human CXCR3. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Goat, Panda (82%). |
Rabbit Polyclonal Anti-IL8RB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-IL8RB antibody: synthetic peptide directed towards the N terminal of human IL8RB. Synthetic peptide located within the following region: MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYF |
Rabbit Polyclonal Anti-CCR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7 |
Rabbit Polyclonal Anti-CCR7 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CCR7 Antibody: A synthesized peptide derived from human CCR7 |
Rabbit Polyclonal Anti-Phospho-CCR5(Ser349) Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Phospho-CCR5(Ser349) Antibody: A synthesized peptide derived from human CCR5 around the phosphorylation site of Sersine 349 |
Modifications | Phospho-specific |
Rabbit Polyclonal CXCR4 Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
CCR3 (N-term) rabbit polyclonal antibody, Purified
Applications | ELISA, IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to acetylated N-terminal sequence of sheep 14-3-3 epsilon. ( N-TERMINAL ) |
CXCR2 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, IP, WB |
Reactivities | Human |
Immunogen | Synthetic peptide mapping at the middle region of human CXCR2 |
CCR5 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | Synthetic peptide corresponding to a sequence at the N-terminal of Human CCR5 |
CCR6 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the C-terminal of human CCR6 |
CXCR3 (Center) rabbit polyclonal antibody, Aff - Purified
Applications | FC, IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 147-175 amino acids from the Central region of Human CXCR3 |
Rabbit Polyclonal CXCR4 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | CXCR4 antibody was raised against a 15 amino acid peptide near the center of human CXCR4. The immunogen is located within amino acids 170 - 220 of CXCR4. |
Rabbit Polyclonal CXCR4-Lo Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CXCR4-Lo antibody was raised against a peptide corresponding to nine amino acids near the amino terminus of human CXCR4 isoform a. |
Rabbit polyclonal CCR5 (Ser349) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human CCR5 around the phosphorylation site of serine 349 (E-I-SP-V-G). |
Modifications | Phospho-specific |
Rabbit polyclonal anti-CCR7 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CCR7. |
CCR4 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Human, Monkey, Gorilla, Gibbon |
Conjugation | Unconjugated |
Immunogen | CCR4 antibody was raised against synthetic 18 amino acid peptide from 2nd extracellular domain of human CCR4. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset (100%); Ferret, Elephant, Panda (94%); Dog, Bovine, Bat, Hamster (89%); Mouse, Rat (83%). |
Rabbit Polyclonal CCR5 (Ser336) Antibody (Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 around the phosphorylation site of Serine 336 |
Modifications | Phospho-specific |
Rabbit Polyclonal CXCR3 Antibody
Applications | IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | CXCR3 antibody was raised against a 19 amino acid peptide near the carboxy terminus of human CXCR3 |
Rabbit Polyclonal CCR7 Antibody
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | CCR7 antibody was raised against a 15 amino acid peptide near the center of human CCR7. |
Rabbit Polyclonal CCR5 Antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against A synthesized peptide derived from human CCR5 |
Rabbit Polyclonal Anti-CCR7 (extracellular)
Applications | FC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Peptide (C)DEVTDDYIGDNTTVD, corresponding to amino acid residues 26-40 of human CCR7. Extracellular, N-terminus. |
CCR7 rabbit polyclonal antibody, Aff - Purified
Applications | IF, WB |
Reactivities | Human |
Immunogen | Synthetic peptide, corresponding to amino acids 280-330 of Human CCR7. |
CX3CR1 (175-189) rabbit polyclonal antibody, Purified
Applications | IF, WB |
Reactivities | Human |
Immunogen | Peptide corresponding to amino acids 175 to 189 of human CX3CR1. |
CCR7 (C-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence mapping at the C-terminal of human CCR7 |
CXCR4 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Immunogen | A synthetic peptide corresponding to a sequence at the N-terminal of human CXCR4 |
Rabbit polyclonal anti-CX3CR1 antibody
Applications | IF, IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CX3CR1. |
Rabbit polyclonal anti-CXCR3 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CXCR3. |
CCR1 Rabbit Polyclonal (Extracellular Domain) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Conjugation | Unconjugated |
Immunogen | CCR1 antibody was raised against synthetic 20 amino acid peptide from 2nd extracellular domain of human CCR1. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Gibbon, Bovine (95%); Mouse (85%); Marmoset (80%). |