Primary Antibodies

View as table Download

Rabbit Polyclonal DUOX2 Antibody

Applications WB
Reactivities Canine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of the human protein (within residues 400-500). [Swiss-Prot# Q9NRD8]

Rabbit Polyclonal GPR83 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken, Primate
Conjugation Unconjugated
Immunogen A portion of amino acids 200-250 of human GPR83 was used as the immunogen for this antibody.

Macrophage Scavenger Receptor I (MSR1) (300-400) rabbit polyclonal antibody

Applications IF, IHC, WB
Reactivities Bovine, Canine, Human, Mouse, Primate, Rat
Conjugation Unconjugated

Rabbit Polyclonal LIMPII/lpg85 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A C-terminal synthetic peptide made to the mouse LIMPII/lgp85 protein sequence. [UniProt# O35114]

Rabbit Polyclonal GRAIL/RNF128 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Equine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids portion of amino acids 227-269 of human GRAIL was used as immunogen, GenBank no. NP_919445.1.

Rabbit Polyclonal Anti-NUCB2 Antibody

Applications IHC, WB
Reactivities Canine, Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-NUCB2 antibody: synthetic peptide directed towards the middle region of human NUCB2. Synthetic peptide located within the following region: MMKEHERREYLKTLNEEKRKEEESKFEEMKKKHENHPKVNHPGSKDQLKE

Rabbit Polyclonal S1P5/EDG-8 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Canine, Primate
Conjugation Unconjugated
Immunogen A synthetic peptide corresponding to amino acids 15-55 of human Edg8 was used as the immunogen, GenBank no NP_110387.

Rabbit Polyclonal AIF Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat, Bovine, Canine
Conjugation Unconjugated
Immunogen (aa 151-170); human

Rabbit Polyclonal Anti-TNFRSF9 Antibody

Applications WB
Reactivities Canine, Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TNFRSF9 antibody: synthetic peptide directed towards the C terminal of human TNFRSF9. Synthetic peptide located within the following region: LTLRFSVVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL

Rabbit Polyclonal Kv1.2 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rabbit, Rat, Xenopus
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 325-375). [Swiss-Prot# P63142]

Rabbit Polyclonal Kv1.2 Antibody

Applications IF
Reactivities Bovine, Canine, Human, Mouse, Porcine, Rat, Xenopus, Zebrafish
Conjugation Unconjugated
Immunogen Synthetic peptide made to a portion of rat Kv1.2 (within residues 50-100). [Swiss-Prot# P63142]

Rabbit Polyclonal SEMA3B Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human SEMA 3B protein sequence (between residues 100-200).

Rabbit Polyclonal Anti-TNF-R1 Antibody

Reactivities Bovine, Canine, Human, Monkey, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Peptide corresponding to AA 20-43 of the mouse TNF-R1 sequence, identical to rat and human over those residues

Rabbit Polyclonal 5-HT7 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine
Conjugation Unconjugated
Immunogen This antibody was developed by immunizing rabbits with a mixture of synthetic peptides corresponding to amino acids 13-28 of the rat 5-HT7R (AAA42134.1).

Rabbit Polyclonal CRHR2/CRF2 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Chicken
Conjugation Unconjugated
Immunogen A portion of amino acids 75-125 of human CRHR2 was used as the immunogen.

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Canine, Feline, Human, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 30-70). [Swiss-Prot# Q07817]

Rabbit Polyclonal Bcl-xL Antibody

Applications WB
Reactivities Human, Mouse, Rat, Canine, Feline, Hamster, Porcin
Conjugation Unconjugated
Immunogen Synthetic peptide made to an N-terminal portion of human BCL2L1 (within residues 1-50). [Swiss-Prot# Q07817]

Rabbit Polyclonal Kv1 Antibody

Applications WB
Reactivities Human, Mouse, Rat, Bovine, Canine, Porcine, Xenopu
Conjugation Unconjugated
Immunogen Synthetic peptide made to rat Kv1.2 (within residues 50-100), which is identical in all members of the Kv1 family.

Rabbit Polyclonal Potassium Channel Kv3.1 Antibody

Applications WB
Reactivities Bovine, Canine, Human, Mouse, Rabbit, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide made to an internal portion of rat Kv3.1 (within residues 350-400). [Swiss-Prot# P25122]