Primary Antibodies

View as table Download

Rabbit anti-ALDH2 Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH2

Rabbit anti-MAOA Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOA

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Rabbit anti-ALDH3A1 Polyclonal Antibody

Applications ICC/IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ALDH3A1

Rabbit anti-HNMT Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HNMT

Rabbit Polyclonal Anti-ALDH2 Antibody - C-terminal region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Aldh2 antibody is synthetic peptide directed towards the C-terminal region of Mouse Aldh2. Synthetic peptide located within the following region: QPTVFGDVKDGMTIAKEEIFGPVMQILKFKTIEEVVGRANDSKYGLAAAV

Rabbit Polyclonal Anti-ABP1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ABP1 antibody: synthetic peptide directed towards the C terminal of human ABP1. Synthetic peptide located within the following region: QFLHNNENIENEDLVAWVTVGFLHIPHSEDIPNTATPGNSVGFLLRPFNF

Rabbit Polyclonal Anti-ALDH1B1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH1B1 antibody: synthetic peptide directed towards the middle region of human ALDH1B1. Synthetic peptide located within the following region: GFFIKPTVFGGVQDDMRIAKEEIFGPVQPLFKFKKIEEVVERANNTRYGL

Rabbit Polyclonal FALDH Antibody

Applications ELISA, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit polyclonal antibody to KAO (amiloride binding protein 1 (amine oxidase (copper-containing)))

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 179 of KAO (Uniprot ID#P19801)

Rabbit Anti-DOPA Decarboxylase, Human Antibody

Applications WB
Reactivities Bovine, Dog, Guinea Porcine, Human, Rabbit, Rat, Sheep
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to amino acid residues from the N-terminal region conjugated to KLH

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

Rabbit Polyclonal antibody to FTCD (formiminotransferase cyclodeaminase)

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 251 of FTCD (Uniprot ID#O95954)

Rabbit polyclonal anti-ALDH3B1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH3B1.

Rabbit polyclonal ASPA Antibody (N-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ASPA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 82-110 amino acids from the N-terminal region of human ASPA.

Rabbit anti-HDC Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human HDC

Rabbit Polyclonal Anti-ALDH7A1 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH7A1 antibody: synthetic peptide directed towards the N terminal of human ALDH7A1. Synthetic peptide located within the following region: NQPQYAWLKELGLREENEGVYNGSWGGRGEVITTYCPANNEPIARVRQAS

Rabbit Polyclonal Anti-DDC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the middle region of human DDC. Synthetic peptide located within the following region: SLKMWFVFRMYGVKGLQAYIRKHVQLSHEFESLVRQDPRFEICVEVILGL

Rabbit Polyclonal Anti-TRMT11 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TRMT11 antibody: synthetic peptide directed towards the N terminal of human TRMT11. Synthetic peptide located within the following region: IKIHTFNKTLTQEEKIKRIDALEFLPFEGKVNLKKPQHVFSVLEDYGLDP

Rabbit Polyclonal Anti-LCMT2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LCMT2 antibody: synthetic peptide directed towards the C terminal of human LCMT2. Synthetic peptide located within the following region: PVLSDWHFLHVGTMAWVRIPVEGEVPEARHSHSACTWQGGALIAGGLGAS

Rabbit Polyclonal Anti-METTL2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

Rabbit Polyclonal Anti-METTL2B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL2B antibody: synthetic peptide directed towards the N terminal of human METTL2B. Synthetic peptide located within the following region: INAHKYWNDFYKIHENGFFKDRHWLFTEFPELAPSQNQNHLKDWFLENKS

Rabbit Polyclonal Anti-LCMT1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LCMT1

Rabbit Polyclonal antibody to Aspartoacylase (aspartoacylase (Canavan disease))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 39 and 300 of Aspartoacylase (Uniprot ID#P45381)

Rabbit polyclonal anti-ALDH1B1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH1B1.

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

Rabbit polyclonal HNMT Antibody (N-term)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This HNMT antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 29-58 amino acids from the N-terminal region of human HNMT.

Rabbit Polyclonal DDC Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC

Rabbit Polyclonal Anti-HAL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAL antibody: synthetic peptide directed towards the C terminal of human HAL. Synthetic peptide located within the following region: EAAHRLLLEQKVWEVAAPYIEKYRMEHIPESRPLSPTAFSLQFLHKKSTK

Rabbit Polyclonal Anti-ALDH1B1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human ALDH1B1

Rabbit Polyclonal ALDH3B1 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the N Terminus Region of the target protein.

Rabbit Polyclonal Aldh3A2 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Aldh3A2 antibody was raised against a 14 amino acid peptide near the carboxy terminus of the human Aldh3A2.

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Rabbit Polyclonal Anti-MAOB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the C terminal of human MAOB. Synthetic peptide located within the following region: GKIPEDEIWQSEPESVDVPAQPITTTFLERHLPSVPGLLRLIGLTTIFSA

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the C terminal of human ALDH3A2. Synthetic peptide located within the following region: FINEREKPLALYVFSHNHKLIKRMIDETSSGGVTGNDVIMHFTLNSFPFG

Rabbit Polyclonal Anti-HAL Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HAL antibody: synthetic peptide directed towards the N terminal of human HAL. Synthetic peptide located within the following region: INKLQELQVNLVRSHSSGVGKPLSPERCRMLLALRINVLAKGYSGISLET

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI

Rabbit Polyclonal Aldh3A1 Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Aldh3A1 antibody was raised against a 13 amino acid peptide near the carboxy terminus of the human Aldh3A1.

Rabbit polyclonal antibody to ALDH3B2 (aldehyde dehydrogenase 3 family, member B2)

Reactivities Human
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 135 and 341 of Human ALDH3B2

Rabbit polyclonal anti-TRMT11 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from Internal of human TRMT11.

Rabbit polyclonal anti-HDC antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide surrounding amino acid 22 of human HDC

Rabbit polyclonal Anti-METTL6 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-METTL6 antibody: synthetic peptide directed towards the N terminal of human METTL6. Synthetic peptide located within the following region: QKLEQEAQKNWDLFYKRNSTNFFKDRHWTTREFEELRSCREFEDQKLTML

Rabbit Polyclonal Anti-WDHD1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-WDHD1 antibody: synthetic peptide directed towards the middle region of human WDHD1. Synthetic peptide located within the following region: KQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP

Rabbit polyclonal Anti-ASPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPA antibody: synthetic peptide directed towards the N terminal of human ASPA. Synthetic peptide located within the following region: RIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTS

Rabbit polyclonal Anti-ASPA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ASPA antibody: synthetic peptide directed towards the middle region of human ASPA. Synthetic peptide located within the following region: IKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADIL

Rabbit polyclonal Anti-MAOA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MAOA antibody: synthetic peptide directed towards the N terminal of human MAOA. Synthetic peptide located within the following region: GPTQNRILRLSKELGIETYKVNVSERLVQYVKGKTYPFRGAFPPVWNPIA

Rabbit polyclonal Anti-MAOA Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-MAOA antibody: synthetic peptide directed towards the middle region of human MAOA. Synthetic peptide located within the following region: NINVTSEPHEVSALWFLWYVKQCGGTTRIFSVTNGGQERKFVGGSGQVSE

Rabbit Polyclonal Anti-ALDH3A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A2 antibody: synthetic peptide directed towards the middle region of human ALDH3A2. Synthetic peptide located within the following region: DHIFYTGNTAVGKIVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDIVCRR