Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
USD 390.00
2 Weeks
SCF (KITLG) mouse monoclonal antibody, Azide Free
| Applications | ELISA, IF, WB |
| Reactivities | Human |
Rabbit Polyclonal Antibody against KITLG (C-term)
| Applications | FC, IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This SCF (KITLG) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 244-273 amino acids from the C-terminal region of human SCF (KITLG). |
Rabbit Polyclonal antibody to CD55 (CD55 molecule, decay accelerating factor for complement (Cromer blood group))
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 71 and 330 of CD55 (Uniprot ID#P08174) |
Rabbit Polyclonal antibody to IL1 receptor 2 (interleukin 1 receptor, type II)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 172 and 398 of IL1 Receptor 2 (Uniprot ID#P27930) |
Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44 |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit polyclonal MME Antibody (Center)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This MME antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 274-302 amino acids from the Central region of human MME. |
Rabbit Polyclonal Anti-ITGA2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ITGA2 antibody is: synthetic peptide directed towards the C-terminal region of Human ITGA2. Synthetic peptide located within the following region: LQNLQNQASLSFQALSESQEENKADNLVNLKIPLLYDAEIHLTRSTNINF |
CD3E mouse monoclonal antibody, clone JXT3, Aff - Purified
| Applications | ELISA, IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
CD4 mouse monoclonal antibody, clone CA-4, Purified
| Applications | IF, IHC |
| Reactivities | Human |
CD19 mouse monoclonal antibody, clone 4G7, Purified
| Applications | FC, IF |
| Reactivities | Human |
CD1 (CD1A) mouse monoclonal antibody, clone MCD1a, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD1 (CD1A) mouse monoclonal antibody, clone MCD1a, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD2 mouse monoclonal antibody, clone B-E2, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD2 mouse monoclonal antibody, clone B-E2, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD5 mouse monoclonal antibody, clone MCD5, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD5 mouse monoclonal antibody, clone MCD5, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD7 mouse monoclonal antibody, clone B-B7, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD7 mouse monoclonal antibody, clone B-B7, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD22 mouse monoclonal antibody, clone B-ly8, FITC
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | FITC |
CD22 mouse monoclonal antibody, clone B-ly8, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
CD38 mouse monoclonal antibody, clone T16, PerCP-Cy5.5
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PerCP-Cy5.5 |
CD55 mouse monoclonal antibody, clone NaM16-4D3, PE
| Applications | FC, IF |
| Reactivities | Human |
| Conjugation | PE |
EPOR rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
IL2 Receptor alpha (IL2RA) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
c Kit (KIT) rabbit polyclonal antibody, Aff - Purified
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
Rabbit polyclonal IL-2Ra/CD25 (Ser268) antibody(Phospho-specific)
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human IL-2Ra/CD25 around the phosphorylation site of serine 268 (R-K-SP-R-R). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: MAPVAGLTWEDSEGTEGSSLLPGEQPLHTVDPGSAKQRPPRSTCQSFEPP |
Rabbit Polyclonal Anti-CSF1 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CSF1 antibody: synthetic peptide directed towards the middle region of human CSF1. Synthetic peptide located within the following region: SGSVLPLGELEGRRSTRDRRSPAEPEGGPASEGAARPLPRFNSVPLTDTG |
Rabbit Polyclonal Anti-IL-11 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | IL-11 antibody was raised against a 16 amino acid peptide from near the amino terminus of human IL-11. The immunogen is located within amino acids 40 - 90 of IL-11. |
Rabbit polyclonal antibody to HLA-DRB3 (major histocompatibility complex, class II, DR beta 3)
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fragment corresponding to a region within amino acids 4 and 266 of HLA-DRB3 (Uniprot ID#P79483) |
Rabbit anti-FLT3 polyclonal antibody
| Applications | IF |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antibody was produced against synthesized non-phosphopeptide derived fromhuman FLT3 around the phosphorylation site of tyrosine 591 (Y-F-YP-V-D). |
Carrier-free (BSA/glycerol-free) IL-6 mouse monoclonal antibody, clone OTI3G9 (formerly 3G9)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Applications
- IF
Pathways
- Hematopoietic cell lineage
Filter by
Category
Target Symbol
- CD19 (49)
- CD1C (45)
- CD33 (35)
- IL1A (32)
- FCGR1A (25)
- CD4 (21)
- CD5 (21)
- CD22 (13)
- CD36 (12)
- CD44 (11)
- TNF (11)
- CD3E (10)
- IL6 (10)
- CD2 (9)
- CD34 (5)
- CD38 (5)
- FLT3LG (5)
- IL3 (5)
- CSF1R (4)
- FLT3 (4)
- ITGA4 (4)
- ITGAM (4)
- CD1A (3)
- CD55 (3)
- CD7 (3)
- FCER2 (3)
- IL1B (3)
- IL6R (3)
- ITGA3 (3)
- ITGA6 (3)
- KITLG (3)
- MS4A1 (3)
- BMP2 (2)
- CD59 (2)
- CSF1 (2)
- EPOR (2)
- IL2RA (2)
- KIT (2)
- CD14 (1)
- CD1E (1)
- CD37 (1)
- CD9 (1)
- CSF2 (1)
- HLA-DRB3 (1)
- IL11 (1)
- IL1R2 (1)
- IL4R (1)
- IL7R (1)
- IL9R (1)
- ITGA2 (1)
- ITGB3 (1)
- MME (1)
Reactivities
Antibody Hosts
Isotypes
Clonalities
Conjugates
Modifications
Families
- Druggable Genome (366)
- Transmembrane (338)
- Secreted Protein (79)
- ES Cell Differentiation/IPS (78)
- Adult stem cells (43)
- Induced pluripotent stem cells (28)
- Cancer stem cells (23)
- Embryonic stem cells (22)
- Stem cell relevant signaling - DSL/Notch pathway (11)
- Transcription Factors (11)
- Protein Kinase (10)
- Stem cell - Pluripotency (2)
- Stem cell relevant signaling - TGFb/BMP signaling pathway (2)
- Protease (1)