Primary Antibodies

View as table Download

Rabbit Monoclonal antibody against Gli-1 (GLI1)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

HDAC1 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen N term -peptide of human HDAC1

Rabbit Monoclonal Antibody against NOTCH1 (Clone EP1238Y)

Applications IF, IHC, WB
Reactivities Human, Mouse, Cow
Conjugation Unconjugated

DLL4 rabbit polyclonal antibody, Purified

Applications ELISA, IHC, WB
Reactivities Human, Monkey, Mouse, Rat
Immunogen Synthetic peptide corresponding to the internal region of human DLL4.

Rabbit Polyclonal Gli1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to an internal portion of the human Gli1 protein (between residues 150-200) [UniProt P08151]

Rabbit polyclonal anti-Cyclin E1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cyclin E1.

DLL3 (C-term) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human
Immunogen Synthetic peptide - KLH conjugated - corresponding to the C-terminal region (between 519-548 aa) of human DLL3.

Rabbit anti-CD44 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CD44

Rabbit Polyclonal DLL3 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Primate
Conjugation Unconjugated
Immunogen A portion of amino acid 100 to 150 of human DLL3 was used as immunogen for the antibody.

Rabbit polyclonal STAT6 (Ab-641) antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human STAT6 around the phosphorylation site of Tyrosine 641.

CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CCND1

Phospho-STAT6-Y641 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A phospho specific peptide corresponding to residues surrounding Y641 of human STAT6
Modifications Phospho-specific

Rabbit anti-STAT5A (Phospho-Tyr694) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of tyrosine 694 (D-G-YP-V-K).
Modifications Phospho-specific

Rabbit polyclonal Notch 1 (Cleaved-Val1744) antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Notch 1.

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CD1.1

Applications ELISA, FC, IF, IHC, IP, WB
Reactivities Human, Rat

Mouse Monoclonal CD44 Antibody (8E2F3)

Applications FC, IHC, WB
Reactivities Human, Mouse (Does not react with: Rabbit)
Conjugation Unconjugated

HDAC1 mouse monoclonal antibody, clone 5C11, Purified

Applications ELISA, IF, IHC, PLA, WB
Reactivities Human, Mouse, Rat

Rabbit polyclonal Cyclin E1 (Ab-395) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-T-P-P).

HDAC1 mouse monoclonal antibody, clone 3E1, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

HDAC1 mouse monoclonal antibody, clone 1D6, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human, Mouse, Rat

HDAC1 mouse monoclonal antibody, clone 5A11, Purified

Applications ELISA, IF, IHC, WB
Reactivities Human

STAT5A pSer780 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Smoothened (SMO) (N-term) rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen SMO antibody was raised against synthetic peptide - KLH conjugated

Rabbit polyclonal Cyclin E1 (Thr395) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Cyclin E1 around the phosphorylation site of threonine 395 (L-L-TP-P-P).
Modifications Phospho-specific

Rabbit polyclonal anti-HDAC1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human HDAC1.

Mouse Anti-Human SMO / Smoothened Monoclonal Antibody

Applications IHC
Reactivities Human

Rabbit polyclonal anti-DELTA-4 antibody

Applications IHC, WB
Reactivities Human, partial reactivity to Mouse and Rat
Conjugation Unconjugated
Immunogen Anti-DELTA-4 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to an internal region of Human DELTA-4.

Anti-CCND1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Cyclin D1 (CCND1) mouse monoclonal antibody, clone CY-D1, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat

Cyclin D1 (CCND1) rabbit polyclonal antibody, Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen CCND1 antibody was raised against kLH conjugated synthetic peptide corresponding to amino acid residues surrounding S90 of human Cyclin D1.

HDAC1 (271-477) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Immunogen Recombinant protein fragment containing a sequence corresponding to a region within amino acids 271 and 477 of HDAC1

HES1 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide.
Epitope: N-Terminus

Rabbit Polyclonal antibody to CD44 (CD44 molecule (Indian blood group))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant protein fragment contain a sequence corresponding to a region within amino acids 1 and 258 of CD44

Rabbit polyclonal anti-HDAC-1 antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Anti-HDAC-1 antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 466-482 of Human HDAC-1.

Rabbit polyclonal Phospho-STAT5a(Y694) Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This STAT5a Antibody is generated from rabbits immunized with a KLH conjugated synthetic phosphopeptide corresponding to amino acid residues surrounding Y694 of human STAT5a.
Modifications Phospho-specific

Rabbit Polyclonal Notch-1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide made to a C-terminal portion of the human NOTCH1 protein (between residues 2300-2350) [UniProt P46531]

STAT5A rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse, Rat

Rabbit anti-STAT5A (Phospho-Ser780) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT5A around the phosphorylation site of serine 780 (R-L-SP-P-P).
Modifications Phospho-specific

Rabbit anti-STAT6 (Phospho-Tyr641) polyclonal antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from humanSTAT6 around the phosphorylation site of Tyrosine 641 (R-G-YP-V-P).
Modifications Phospho-specific

Rabbit polyclonal STAT6 phospho Y641 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen STAT6 phospho Y641 Antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to residues surrounding Y641 of human STAT6 protein.

Rabbit Polyclonal Cyclin E1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1.

Rabbit Polyclonal Cyclin E1 (Thr395) Antibody (Phospho-specific)

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against a synthesized A synthesized peptide derived from human Cyclin E1 around the phosphorylation site of Threonine 395.
Modifications Phospho-specific

Anti-Human Oncostatin M Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human Oncostatin M (227 a.a.)

Rabbit Polyclonal anti-STAT6 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-STAT6 antibody: synthetic peptide directed towards the C terminal of human STAT6. Synthetic peptide located within the following region: NLYPKKPKDEAFRSHYKPEQMGKDGRGYVPATIKMTVERDQPLPTPELQM

Rabbit Polyclonal Anti-SMO Antibody (1st Extracellular Domain)

Applications IHC
Reactivities Human
Immunogen SMO / Smoothened antibody was raised against synthetic 16 amino acid peptide from 1st extracellular domain of human SMO. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit, Pig, Turkey, Chicken, Platypus, Xenopus (94%); Opossum (88%).

CD44 mouse monoclonal antibody, clone 156-3C11, Purified

Applications IHC
Reactivities Human

HDAC1 pSer421/423 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat

HDAC1 rabbit polyclonal antibody, Aff - Purified

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

NOTCH1 (C-term) rabbit polyclonal antibody, Purified

Applications IHC
Reactivities Human
Immunogen A synthetic peptide from C-terminal of human notch-1