Primary Antibodies

View as table Download

Rabbit Polyclonal Anti-NGF Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human NGF

DCN Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human DCN

Rabbit Polyclonal IFN-beta Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen IFN-beta antibody was raised against a 17 amino acid synthetic peptide from near the center of human IFN-b. The immunogen is located within amino acids 110 - 160 of IFN-beta.

Rabbit polyclonal EGFR (Ab-1172) antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human EGFR around the phosphorylation site of tyrosine 1172 (P-D-YP-Q-Q).

Anti-ADAMTS5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 529-541 amino acids of Human A disintegrin and metalloproteinase with thrombospondin motifs 5

Rabbit Polyclonal Anti-ISG15 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-ISG15 antibody: synthetic peptide directed towards the middle region of human ISG15. Synthetic peptide located within the following region: EPLSILVRNNKGRSSTYEVRLTQTVAHLKQQVSGLEGVQDDLFWLTFEGK

Rabbit Polyclonal Anti-MGP

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MGP antibody: synthetic peptide directed towards the middle region of human MGP. Synthetic peptide located within the following region: INRRNANTFISPQQRWRAKVQERIRERSKPVHELNREACDDYRLCERYAM

Neuropeptide Y (NPY) (68-97) rabbit polyclonal antibody, Serum

Applications IF, IHC
Reactivities Human, Rat
Immunogen Synthetic Prepro-NPY 68-97 (C-PON).

Rabbit Polyclonal SLPI Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen SLPI antibody was raised against a 17 amino acid peptide from near the center of human SLPI.

Rabbit Polyclonal Anti-FGF2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FGF2 antibody: synthetic peptide directed towards the middle region of human FGF2. Synthetic peptide located within the following region: RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Rabbit Polyclonal Anti-PTHLH Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PTHLH antibody: synthetic peptide directed towards the middle region of human PTHLH. Synthetic peptide located within the following region: YKEQPLKTPGKKKKGKPGKRKEQEKKKRRTRSAWLDSGVTGSGLEGDHLS

Rabbit Polyclonal VGF Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen VGF antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of the human VGF. The immunogen is located within the last 50 amino acids of VGF.

Rabbit Polyclonal antibody to Laminin beta 3 (laminin, beta 3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 644 and 960 of Laminin beta 3 (Uniprot ID#Q13751)

ADAMTS1 Rabbit Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen ADAMTS1 antibody was raised against synthetic 18 amino acid peptide from internal region of human ADAMTS1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Rabbit, Horse, Pig (100%); Bat, Bovine, Panda, Xenopus (94%); Mouse, Dog, Hamster, Elephant, Opossum (89%); Rat, Sheep, Turkey, Chicken (83%).

Rabbit polyclonal FOLR1 Antibody (N-term)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This FOLR1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 33-68 amino acids from the N-terminal region of human FOLR1.

Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172)

Rabbit polyclonal anti-ST6GAL1 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ST6GAL1.

Rabbit polyclonal CMGA Antibody (C-term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This CMGA antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 376-404 amino acids from the C-terminal region of human CMGA.

Anti-Human TIMP-1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen E.coli derived Recombinant Human TIMP-1

Anti-VEGFA Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide corresponding to a region derived from 23-36 amino acids of human vascular endothelial growth factor A

Rabbit Polyclonal WFDC2 Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen WFDC2 antibody was raised against a 16 amino acid peptide near the amino terminus of human WFDC2

Goat Polyclonal Antibody against SERPINE1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-GFKIDDKGMAPALRH, from the internal region of the protein sequence according to NP_000593.1.

Anti-VTN Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 141-154 amino acids of human vitronectin

Anti-PLAT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue

Anti-LIF Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 34-47 amino acids of Human leukemia inhibitory factor

Anti-KLK5 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 279-293 amino acids of Human kallikrein-related peptidase 5

Anti-SV2A Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 21-35 amino acids of human synaptic vesicle glycoprotein 2A

Anti-SCGB1A1 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 22-91 amino acids of human secretoglobin, family 1A, member 1 (uteroglobin)

Anti-TFF1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 25-84 amino acids of human trefoil factor 1

Anti-SERPINB5 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-TNFRSF11B Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 195-365 amino acids of human tumor necrosis factor receptor superfamily, member 11b

Anti-SERPINA3 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to C terminal 300 amino acids of human serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 3

Anti-AACT Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 290-303 amino acids of Human Alpha-1-antichymotrypsin

Anti-PLAUR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 23-305 amino acids of human plasminogen activator, urokinase receptor

Anti-GAS6 Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 690-705 amino acids of Human growth arrest-specific 6

Anti-SPP1 Rabbit Polyclonal Antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 17-300 amino acids of human secreted phosphoprotein 1

Anti-ADAMDEC1 Rabbit Polyclonal Antibody

Applications ELISA, IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 206-340 amino acids of human ADAM-like, decysin 1

Anti-KLK7 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 30-253 amino acids of human kallikrein-related peptidase 7kallikrein-related peptidase 7

Anti-IL18 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Full length fusion protein

Anti-SYT7 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 54-200 amino acids of human synaptotagmin VII

Rabbit Polyclonal Anti-IL17RB Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IL17RB

Rabbit Polyclonal Anti-WNT2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Synthetic peptide of human WNT2