Germany
Japan
United Kingdom
China
Primary Antibodies
View as table Download
Rabbit polyclonal anti-RyR2 (Ser2808) antibody (Phospho-specific)
| Applications | IHC |
| Conjugation | Unconjugated |
| Immunogen | The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific phosphopeptide. The antibody against non-phosphopeptide was removed by chromatography using non-phosphopeptide corresponding to the phosphorylation site. |
| Modifications | Phospho-specific |
ITGA3 / CD49c Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bovine, Gorilla, Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA3 / CD49c antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA3 / CD49c. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Bovine (100%); Marmoset, Mouse, Dog, Bat, Hamster, Elephant, Horse, Opossum (94%); Rabbit (89%). |
Rabbit polyclonal beta Catenin antibody
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat, Xenopus, Zebrafish |
| Conjugation | Unconjugated |
| Immunogen | beta catenin antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to catenin beta-1 C-terminus. |
Anti-SHC1 (Phospho-Tyr427) Rabbit Polyclonal Antibody
| Applications | IF, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Peptide sequence around phosphorylation site of tyrosine 427 (P-S-Y(p)-V-N derived from Human Shc1. |
| Modifications | Phospho-specific |
Rabbit polyclonal CACNG6 Antibody (Center)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This CACNG6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 108-136 amino acids from the Central region of human CACNG6. |
Rabbit polyclonal ITGA6 Antibody (isoform 2 S1064)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ITGA6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1043-1072 amino acids from human ITGA6. |
Rabbit polyclonal JUP Antibody (C-term)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This JUP antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 636-663 amino acids from the C-terminal region of human JUP. |
Mouse Monoclonal ITGB3 (CD61) Antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-LEF1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-LEF1 antibody: synthetic peptide directed towards the C terminal of human LEF1. Synthetic peptide located within the following region: VKPQHEQRKEQEPKRPHIKKPLNAFMLYMKEMRANVVAECTLKESAAINQ |
Rabbit polyclonal beta-Catenin (Ser37) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human β-Catenin around the phosphorylation site of serine 37 (I-H-SP-G-A). |
| Modifications | Phospho-specific |
Rabbit polyclonal Integrin beta3 (Ab-785) antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized non-phosphopeptide derived from human Integrin β3 around the phosphorylation site of tyrosine 785 (I-T-YP-R-G). |
Rabbit polyclonal ITGB4 (Tyr1510) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human ITGB4 around the phosphorylation site of tyrosine 1510 (R-D-YP-S-T). |
| Modifications | Phospho-specific |
Rabbit Polyclonal anti-TCF7L1 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7L1 antibody: synthetic peptide directed towards the N terminal of human TCF7L1. Synthetic peptide located within the following region: NDELIPFQDEGGEEQEPSSDSASAQRDLDEVKSSLVNESENQSSSSDSEA |
Rabbit Polyclonal Anti-TCF7 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TCF7 antibody: synthetic peptide directed towards the middle region of human TCF7. Synthetic peptide located within the following region: PAAIPHPAIVPPSGKQELQPFDRNLKTQAESKAEKEAKKPTIKKPLNAFM |
Rabbit Polyclonal Anti-CACNB1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the middle region of human CACNB1. Synthetic peptide located within the following region: TRRPTPPASGNEMTNLAFELDPLELEEEEAELGEQSGSAKTSVSSVTTPP |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gibbon, Monkey (100%); Gorilla, Marmoset, Mouse, Bovine, Elephant, Horse (93%); Rat, Panda, Pig (86%). |
Rabbit Polyclonal Anti-GJA1 Antibody (C-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | GJA1 / CX43 / Connexin 43 antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GJA1 / Connexin 43. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Rabbit, Pig, Opossum, Guinea pig (100%); Bat, Horse, Chicken, Lizard, Xenopus (94%); Trout, Salmon (88%); Zebrafish, Sea anemone, Nematode (81%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 17 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Dog, Bat, Panda, Horse (94%); Sheep, Bovine, Cat, Elephant, Pig (88%). |
Rabbit Polyclonal Anti-ITGA2 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA2 / CD49b antibody was raised against synthetic 16 amino acid peptide from extracellular domain of human ITGA2 / CD49b. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Dog, Panda, Pig (100%); Bovine, Elephant, Horse, Chicken, Lizard (94%); Opossum, Turkey (88%); Bat, Hamster, Stickleback (81%). |
Rabbit Polyclonal Anti-ITGB1 Antibody (Extracellular Domain)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGB1 / Integrin Beta 1 / CD29 antibody was raised against synthetic 14 amino acid peptide from extracellular domain of human Integrin Beta 1. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Sheep, Dog, Bovine, Cat, Elephant, Panda, Horse, Pig (100%); Platypus (93%); Bat, Opossum (86%). |
Rabbit Polyclonal Anti-CACNA1C Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | CACNA1C / Cav1.2 antibody was raised against synthetic 16 amino acid peptide from internal region of human CACNA1C / Cav1.2. Percent identity with other species by BLAST analysis: Human, Gibbon (100%); Gorilla, Monkey, Marmoset (94%). |
Rabbit Polyclonal Anti-ITGA6 Antibody (N-Terminus)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA6/Integrin Alpha 6/CD49f antibody was raised against synthetic 18 amino acid peptide from N-terminus of human ITGA6 / CD49f. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse (100%); Platypus (94%); Opossum (89%); Turkey, Chicken (83%). |
Rabbit Polyclonal Anti-ITGA4 Antibody (Internal)
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | ITGA4 / VLA-4 / CD49d antibody was raised against synthetic 14 amino acid peptide from internal region of human ITGA4 / VLA-4. Percent identity with other species by BLAST analysis: Human (100%), Gorilla (100%), Gibbon (100%), Monkey (100%), Marmoset (100%), Mouse (100%), Rat (100%), Elephant (93%), Panda (93%), Dog (86%), Bat (86%), Bovine (86%), Rabbit (86%), Horse (86%), Pig (86%). |
Carrier-free (BSA/glycerol-free) DES mouse monoclonal antibody, clone OTI4G1 (formerly 4G1)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI1B11 (formerly 1B11)
| Applications | FC, IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) CTNNB1 mouse monoclonal antibody, clone OTI12H7 (formerly 12H7)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
Active filters
Applications
- IHC
Conjugates
- Unconjugated
Pathways
- Arrhythmogenic right ventricular cardiomyopathy (ARVC)
Filter by
Category
Target Symbol
- CTNNB1 (47)
- DES (19)
- JUP (13)
- CDH2 (11)
- SHC1 (10)
- ITGB3 (9)
- ACTB (7)
- ACTN1 (6)
- LEF1 (5)
- LMNA (5)
- ACTN2 (4)
- CTNNA1 (4)
- GJA1 (4)
- ITGB1 (4)
- ACTN4 (3)
- CACNA1C (3)
- DSG2 (3)
- ITGA2 (3)
- ITGA6 (3)
- SGCD (3)
- CACNB1 (2)
- DMD (2)
- DSC2 (2)
- DSP (2)
- EMD (2)
- ITGA2B (2)
- ITGA7 (2)
- ITGB4 (2)
- RYR2 (2)
- ACTG1 (1)
- ACTN3 (1)
- ATP2A2 (1)
- CACNA1D (1)
- CACNA1S (1)
- CACNA2D2 (1)
- CACNB2 (1)
- CACNG6 (1)
- ITGA11 (1)
- ITGA3 (1)
- ITGA4 (1)
- ITGAV (1)
- ITGB5 (1)
- ITGB6 (1)
- ITGB7 (1)
- LAMA2 (1)
- SGCA (1)
- TCF7 (1)
- TCF7L1 (1)
Reactivities
- Human (197)
- Mouse (171)
- Rat (150)
- Monkey (35)
- Dog (33)
- Bovine (10)
- Chicken (6)
- Horse (5)
- Bat (3)
- Pig (3)
- Rabbit (3)
- Xenopus (3)
- Chimpanzee (2)
- Hamster (2)
- Rhesus Monkey (2)
- All Species (1)
- Avian (1)
- Cow (1)
- Feline (1)
- Gorilla (1)
- Guinea Pig (1)
- Porcine (1)
- Primate (1)
- Sheep (1)
- X. tropicalis (1)
- Zebrafish (1)