Primary Antibodies

View as table Download

Rabbit anti-ADH5 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human ADH5

Rabbit Polyclonal Anti-PNPLA3 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPLA3 antibody: synthetic peptide directed towards the C terminal of human PNPLA3. Synthetic peptide located within the following region: CSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKS

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI2F10 (formerly 2F10)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

MAOA (Monoamine Oxidase A) mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the C terminal of human FAH. Synthetic peptide located within the following region: AATICKSNFKYMYWTMLQQLTHHSVNGCNLRPGDLLASGTISGPEPENFG

Carrier-free (BSA/glycerol-free) MAOA mouse monoclonal antibody, clone OTI1D6 (formerly 1D6)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated

Rabbit anti-MAOA Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOA

Rabbit Polyclonal Anti-FAH Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-FAH antibody: synthetic peptide directed towards the N terminal of human FAH. Synthetic peptide located within the following region: SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT

Rabbit Polyclonal Anti-GOT1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GOT1 antibody: synthetic peptide directed towards the N terminal of human GOT1. Synthetic peptide located within the following region: MAPPSVFAEVPQAQPVLVFKLTADFREDPDPRKVNLGVGAYRTDDCHPWV

Rabbit anti-MAOB Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human MAOB

Rabbit Polyclonal Anti-DDC Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-DDC antibody: synthetic peptide directed towards the N terminal of human DDC. Synthetic peptide located within the following region: EFRRRGKEMVDYVANYMEGIEGRQVYPDVEPGYLRPLIPAAAPQEPDTFE

Rabbit polyclonal antibody to Dopamine beta-Hydroxylase (dopamine beta-hydroxylase (dopamine beta-monooxygenase))

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 8 and 320 of Dopamine beta Hydroxylase (Uniprot ID#P09172)

TYR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human TYR

Rabbit Polyclonal Anti-ADH1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

Goat Polyclonal Antibody against PNPLA3

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence EHDICPKVKSTN, from the internal region of the protein sequence according to NP_473429.2.

Rabbit Polyclonal antibody to WBSCR22 (Williams Beuren syndrome chromosome region 22)

Applications IHC, IP, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 263 of WBSCR22 (Uniprot ID#O43709)

Rabbit polyclonal Tyrosine Hydroxylase (Ab-19) antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized non-phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q).

Rabbit polyclonal Tyrosine Hydroxylase (Ser19)(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 19 (A-V-SP-E-Q).
Modifications Phospho-specific

Rabbit polyclonal anti-ALDH3B1 antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human ALDH3B1.

Rabbit polyclonal anti-AOX1 antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human AOX1.

Aspartate Aminotransferase Goat Polyclonal (aa157-167) Antibody

Applications IHC
Reactivities Gibbon, Chimpanzee, Gorilla, Hamster, Human, Orang-Utan, Rat
Conjugation Unconjugated
Immunogen Aspartate Aminotransferase antibody was raised against synthetic peptide C-RSYRYWDAEKR from an internal region of human GOT1 (NP_002070.1). Percent identity by BLAST analysis: Human, Chimpanzee, Gorilla, Orangutan, Gibbon, Monkey, Rat, Hamster, Elephant (100%); Marmoset, Goat, Pig, Lizard (91%); Mouse, Panda, Bat, Bovine, Horse, Opossum, Turkey, Chicken, Platypus, Xenopus, Salmon, Pufferfish, Seq squirt (82%).

Monoamine Oxidase B / MAOB Goat Polyclonal (Internal) Antibody

Applications IHC
Reactivities Gibbon, Bovine, Guinea pig, Gorilla, Horse, Human, Monkey, Orang-Utan, Pig, Rabbit
Conjugation Unconjugated
Immunogen MAOB / Monoamine Oxidase B antibody was raised against synthetic peptide C-HKARKLARLTKEE from an internal region of human MAOB (NP_000889.3). Percent identity by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Elephant, Bovine, Rabbit, Horse, Pig, Opossum, Guinea pig (100%); Mouse, Rat, Panda, Dog (92%); Bat (85%).

Anti-COMT Goat Polyclonal Antibody

Applications IHC
Reactivities Gorilla, Human
Conjugation Unconjugated
Immunogen COMT antibody was raised against synthetic peptide GDTKEQRILNHVLQC from the N-terminus of human COMT (NP_000745.1; NP_001128633.1; NP_001128634.1; NP_009294.1). Percent identity by BLAST analysis: Human, Gorilla (100%); Gibbon, Monkey, Marmoset, Panda, Dog (93%); Hamster, Bat, Horse (86%).

Rabbit polyclonal ADH1B Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B.

Rabbit polyclonal ADH7 Antibody (C-Term)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ADH7 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 318-346 amino acids from the C-terminal region of human ADH7.

Rabbit Polyclonal Anti-TYRP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-TYRP1 antibody: synthetic peptide directed towards the middle region of human TYRP1. Synthetic peptide located within the following region: NDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWP

Rabbit Polyclonal Anti-LCMT1 Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human LCMT1

Goat Anti-AOC3 Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DEDPSFYSADSIY, from the internal region (near the C Terminus) of the protein sequence according to NP_003725.1.

Rabbit Polyclonal TYW4 Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TYW4 antibody was raised against a 16 amino acid synthetic peptide near the amino terminus of human TYW4.

Anti-ADH1B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide

Rabbit polyclonal ADH4 Antibody (C-term)

Applications FC, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen This ADH4 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 319-348 amino acids from the C-terminal region of human ADH4.

Rabbit polyclonal AOC3 Antibody (Center)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This AOC3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 613-640 amino acids from the Central region of human AOC3.

Rabbit Polyclonal DDC Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen DDC antibody was raised against a 14 amino acid peptide near the carboxy terminus of human DDC

Rabbit anti FAH (Fumarylacetoacetat Hydrolase) Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A full length recombinant protein of FAH from mouse origin

Goat Polyclonal Antibody against thyroid peroxidase

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-TRHVIQVSNEVVTDD, from the internal region of the protein sequence according to NP_000538.3; NP_783650.1; NP_783652.1; NP_783653.1.

Rabbit polyclonal Tyrosine Hydroxylase (Ser31) antibody(Phospho-specific)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized phosphopeptide derived from human Tyrosine Hydroxylase around the phosphorylation site of serine 31 (V-T-SP-P-R).
Modifications Phospho-specific

Rabbit Polyclonal Anti-MAOB Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-MAOB Antibody: synthetic peptide directed towards the N terminal of human MAOB. Synthetic peptide located within the following region: RDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILRLAKELGLETYKVNEV

Rabbit Polyclonal Anti-ADH4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: PLTNLCGKISNLKSPASDQQLMEDKTSRFTCKGKPVYHFFGTSTFSQYTV

Rabbit Polyclonal Anti-ADH4 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-ADH4 Antibody: synthetic peptide directed towards the middle region of human ADH4. Synthetic peptide located within the following region: NSEKFVKAKALGATDCLNPRDLHKPIQEVIIELTKGGVDFALDCAGGSET

Rabbit anti-GOT1 Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human GOT1

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the C terminal of human ALDH3A1. Synthetic peptide located within the following region: KFMNSGQTCVAPDYILCDPSIQNQIVEKLKKSLKEFYGEDAKKSRDYGRI

Rabbit Polyclonal Anti-ALDH3A1 Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ALDH3A1 antibody: synthetic peptide directed towards the N terminal of human ALDH3A1. Synthetic peptide located within the following region: DLHKNEWNAYYEEVVYVLEEIEYMIQKLPEWAADEPVEKTPQTQQDELYI

Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1B6 (formerly 1B6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH3A1 mouse monoclonal antibody, clone OTI1C6 (formerly 1C6)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) PNMT mouse monoclonal antibody, clone OTI2F3 (formerly 2F3)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ALDH1A3 mouse monoclonal antibody, clone OTI4B6 (formerly 4B6)

Applications FC, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated